GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cysK in Echinicola vietnamensis KMM 6221, DSM 17526

Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate Echvi_1734 Echvi_1734 Cystathionine beta-lyases/cystathionine gamma-synthases

Query= SwissProt::P06106
         (444 letters)



>lcl|FitnessBrowser__Cola:Echvi_1734 Echvi_1734 Cystathionine
           beta-lyases/cystathionine gamma-synthases
          Length = 369

 Score =  197 bits (501), Expect = 5e-55
 Identities = 144/437 (32%), Positives = 223/437 (51%), Gaps = 74/437 (16%)

Query: 5   FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTS 64
           F+T+ +H G++      HR+   PI  T S  FE+ +             +YSR QNP  
Sbjct: 3   FETLAIHGGEKKSAP--HRAVVQPI--TLSTTFEHHEES----------LIYSRSQNPNR 48

Query: 65  NVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKR 124
             LEE +A LE G+AA A SSG AA     Q L   G +IV+ S +Y G   Q    FK 
Sbjct: 49  MALEELLAQLEKGSAAAAFSSGNAAGMAVFQALP-LGSHIVAPSDMYHGLKKQLVELFKD 107

Query: 125 FGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDN 184
             +E  F +  +PE  EK     TK +++ET  NP   + D  ++  +A +  I VV DN
Sbjct: 108 -KLEVTFTDLSDPENLEKAIQPNTKLLWIETPSNPMLKISDIRRLTKMAKEDDIRVVCDN 166

Query: 185 TFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIV--DSGKFPWKDYPEKFPQFSQ 242
           TF A   F  P++ GAD+V HSATK+ GGH   +GG ++   S +F WK           
Sbjct: 167 TF-ATPVFQNPLELGADLVMHSATKYFGGHSDILGGALITKKSDEF-WKQ---------- 214

Query: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGEN 302
                              IV+V+    +  G +++PF  +LL++ ++TL+ R   H E+
Sbjct: 215 -------------------IVNVQ----QTGGAVLSPFDCYLLVRSIKTLAYRMRGHAEH 251

Query: 303 ALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLP-NADKETDP 361
           A  +A +L+Q P V  V YPGL +H  H+ AK  ++ GFGG+LSF VK  P +ADK    
Sbjct: 252 AGMIATFLDQHPKVERVFYPGLTAHPGHDVAKSQMT-GFGGILSFLVKGKPEDADK---- 306

Query: 362 FKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGI 421
                  ++ +LK  +N  ++G  ++L+        ++    E   +   ++LIR+SVG+
Sbjct: 307 -------LISSLKYYTNATSLGGVESLI--------ERRAAVEGPDTKTPQNLIRLSVGL 351

Query: 422 EFIDDIIADFQQSFETV 438
           E +DD++ D +++F ++
Sbjct: 352 EHLDDLLEDMEKAFYSI 368


Lambda     K      H
   0.317    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 380
Number of extensions: 19
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 444
Length of database: 369
Length adjustment: 31
Effective length of query: 413
Effective length of database: 338
Effective search space:   139594
Effective search space used:   139594
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory