Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate Echvi_1734 Echvi_1734 Cystathionine beta-lyases/cystathionine gamma-synthases
Query= SwissProt::P06106 (444 letters) >FitnessBrowser__Cola:Echvi_1734 Length = 369 Score = 197 bits (501), Expect = 5e-55 Identities = 144/437 (32%), Positives = 223/437 (51%), Gaps = 74/437 (16%) Query: 5 FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTS 64 F+T+ +H G++ HR+ PI T S FE+ + +YSR QNP Sbjct: 3 FETLAIHGGEKKSAP--HRAVVQPI--TLSTTFEHHEES----------LIYSRSQNPNR 48 Query: 65 NVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKR 124 LEE +A LE G+AA A SSG AA Q L G +IV+ S +Y G Q FK Sbjct: 49 MALEELLAQLEKGSAAAAFSSGNAAGMAVFQALP-LGSHIVAPSDMYHGLKKQLVELFKD 107 Query: 125 FGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDN 184 +E F + +PE EK TK +++ET NP + D ++ +A + I VV DN Sbjct: 108 -KLEVTFTDLSDPENLEKAIQPNTKLLWIETPSNPMLKISDIRRLTKMAKEDDIRVVCDN 166 Query: 185 TFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIV--DSGKFPWKDYPEKFPQFSQ 242 TF A F P++ GAD+V HSATK+ GGH +GG ++ S +F WK Sbjct: 167 TF-ATPVFQNPLELGADLVMHSATKYFGGHSDILGGALITKKSDEF-WKQ---------- 214 Query: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGEN 302 IV+V+ + G +++PF +LL++ ++TL+ R H E+ Sbjct: 215 -------------------IVNVQ----QTGGAVLSPFDCYLLVRSIKTLAYRMRGHAEH 251 Query: 303 ALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLP-NADKETDP 361 A +A +L+Q P V V YPGL +H H+ AK ++ GFGG+LSF VK P +ADK Sbjct: 252 AGMIATFLDQHPKVERVFYPGLTAHPGHDVAKSQMT-GFGGILSFLVKGKPEDADK---- 306 Query: 362 FKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGI 421 ++ +LK +N ++G ++L+ ++ E + ++LIR+SVG+ Sbjct: 307 -------LISSLKYYTNATSLGGVESLI--------ERRAAVEGPDTKTPQNLIRLSVGL 351 Query: 422 EFIDDIIADFQQSFETV 438 E +DD++ D +++F ++ Sbjct: 352 EHLDDLLEDMEKAFYSI 368 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 444 Length of database: 369 Length adjustment: 31 Effective length of query: 413 Effective length of database: 338 Effective search space: 139594 Effective search space used: 139594 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory