Align glycine hydroxymethyltransferase (EC 2.1.2.1) (characterized)
to candidate Echvi_1188 Echvi_1188 Glycine/serine hydroxymethyltransferase
Query= metacyc::SGL_RS04690-MONOMER (427 letters) >FitnessBrowser__Cola:Echvi_1188 Length = 422 Score = 469 bits (1207), Expect = e-137 Identities = 240/419 (57%), Positives = 298/419 (71%), Gaps = 15/419 (3%) Query: 13 DPALAAIIDRELQRQRTHIELIASENFTSAAVMAAQGSVLTNKYAEGLPGKRYYGGCEFV 72 D + +I +E RQ+ IELIASENFTS VM A GSVLTNKYAEGLP KRYYGGCE V Sbjct: 4 DQVIFDLIQKEEDRQKRGIELIASENFTSKQVMEAAGSVLTNKYAEGLPKKRYYGGCEVV 63 Query: 73 DQAETLAISRVKELFGAAHANVQPHSGAQANFAVFLTLLQPGDTIMGMDLSHGGHLTHGS 132 D E +AI R KELFGA ANVQPHSGAQAN AVFL L PGD I+G DLSHGGHLTHGS Sbjct: 64 DDIEQIAIDRAKELFGATWANVQPHSGAQANAAVFLACLNPGDHILGFDLSHGGHLTHGS 123 Query: 133 PVNVSGKWFEVAHYGVEKETGRLDYDKIRQQALEVKPKLLICGYSAYPRQIEFDKFRAIA 192 PVN SGK ++ YGVE+ETG +D DK+ ++A EVKPKL+ICG SAY R ++ +FR IA Sbjct: 124 PVNFSGKNYKPHFYGVEEETGIIDMDKVAEKAREVKPKLIICGASAYSRDWDYARFREIA 183 Query: 193 DEVGAYLMADIAHIAGLVASGHHPSPLPYCDVVTTTTHKTLRGPRGGLIMTNNE------ 246 DEVGA L+ADI+H AGL+A G PL +C +VTTTTHKTLRG RGGLIM + Sbjct: 184 DEVGALLLADISHPAGLIARGLLKDPLEHCHIVTTTTHKTLRGTRGGLIMMREDFDNPFG 243 Query: 247 ---------ELGKKFDKSVFPGTQGGPLEHVITAKAVAFGEALKPEFKVYSGQVIANAQA 297 ++ + D +VFPG QGGPLEH+I AKA+AF EAL E+ Y QV NA Sbjct: 244 IKNPKGELRKMTQLLDSAVFPGMQGGPLEHIIAAKAIAFQEALSDEYMEYILQVKKNASI 303 Query: 298 MADQLQKRGFDLVSGGTDNHLMLVDLRSIAMTGKVGDQLLGEINITANKNTVPFDPESPF 357 MAD ++G+ L+SGGTDNHLML+DLR+ ++GK+ ++ LG+++IT NKN VPFD SPF Sbjct: 304 MADAFVEKGYKLISGGTDNHLMLIDLRNKDLSGKIAEETLGKVDITINKNMVPFDTRSPF 363 Query: 358 VTSGLRLGSPAMTTRGMQEDEFRTIANIIADRLLSPEDEGVKADCLRRVSELCAGFPLY 416 VTSG+R+G+ A+T+RG++E E I ++I L++ EDE A + V++ FPLY Sbjct: 364 VTSGMRVGTAAITSRGLKEQEMTKIVDLIDRALMNHEDEAALAKIKQEVNDWMVQFPLY 422 Lambda K H 0.319 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 422 Length adjustment: 32 Effective length of query: 395 Effective length of database: 390 Effective search space: 154050 Effective search space used: 154050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory