GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisE in Echinicola vietnamensis KMM 6221, DSM 17526

Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate Echvi_2517 Echvi_2517 phosphoribosyl-ATP pyrophosphohydrolase

Query= ecocyc::HISTCYCLOPRATPPHOS
         (203 letters)



>lcl|FitnessBrowser__Cola:Echvi_2517 Echvi_2517 phosphoribosyl-ATP
           pyrophosphohydrolase
          Length = 201

 Score =  211 bits (536), Expect = 9e-60
 Identities = 103/196 (52%), Positives = 140/196 (71%), Gaps = 1/196 (0%)

Query: 9   ELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETS 68
           ++D++K +GL+P I+Q A +  VLMLGYMN EAL KT ESGKVTFFSRTKQRLWTKGETS
Sbjct: 5   KIDFDKVNGLVPAIIQDATTNAVLMLGYMNEEALQKTQESGKVTFFSRTKQRLWTKGETS 64

Query: 69  GNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGD-TAHQWLFLYQLEQLLAERKS 127
           GNF++V SI  DCDNDTLL+ A+P+GP CH G  +CF +    +  F+ QL  ++ +RK+
Sbjct: 65  GNFMHVQSIKVDCDNDTLLIKADPVGPVCHTGADTCFDEKNTSKTAFIDQLRSIIKDRKN 124

Query: 128 ADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQDQ 187
              + SYTA L+A G  ++AQKVGEE VE  + A    +     EA+DL++H LVLL+ +
Sbjct: 125 NPTDKSYTASLFAKGINKVAQKVGEEAVEIVIEAKDDHKDLFMGEAADLLFHYLVLLEAK 184

Query: 188 GLDLTTVIENLRKRHQ 203
           G +L  V++ L +RH+
Sbjct: 185 GYELDEVMDVLIQRHK 200


Lambda     K      H
   0.317    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 131
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 203
Length of database: 201
Length adjustment: 21
Effective length of query: 182
Effective length of database: 180
Effective search space:    32760
Effective search space used:    32760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)

Align candidate Echvi_2517 Echvi_2517 (phosphoribosyl-ATP pyrophosphohydrolase)
to HMM PF01502 (PRA-CH)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF01502.18.hmm
# target sequence database:        /tmp/gapView.29204.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PRA-CH  [M=74]
Accession:   PF01502.18
Description: Phosphoribosyl-AMP cyclohydrolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
    3.5e-37  112.5   0.1    5.8e-37  111.7   0.1    1.4  1  lcl|FitnessBrowser__Cola:Echvi_2517  Echvi_2517 phosphoribosyl-ATP py


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cola:Echvi_2517  Echvi_2517 phosphoribosyl-ATP pyrophosphohydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.7   0.1   5.8e-37   5.8e-37       1      73 [.      29     101 ..      29     102 .. 0.99

  Alignments for each domain:
  == domain 1  score: 111.7 bits;  conditional E-value: 5.8e-37
                                          EEEEE-HHHHHHHHHHSB-EEEETTTTEEEETTTTTS--EEEEEEEE-TTSSEEEEEEEESS-SSTTSBSSS- CS
                               PRA-CH   1 mlaymnkealektletgkavyySrsrkklWkKGetSgnvqkvkeirlDcDqDalllkveqkgaaCHtgkesCF 73 
                                          ml+ymn+eal+kt e+gk++++Sr++++lW+KGetSgn+++v++i++DcD+D+ll+k+++ g++CHtg+++CF
  lcl|FitnessBrowser__Cola:Echvi_2517  29 MLGYMNEEALQKTQESGKVTFFSRTKQRLWTKGETSGNFMHVQSIKVDCDNDTLLIKADPVGPVCHTGADTCF 101
                                          9************************************************************************ PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                          1  (201 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 4.30
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory