Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (characterized)
to candidate Echvi_2919 Echvi_2919 Ornithine/acetylornithine aminotransferase
Query= SwissProt::P40732 (405 letters) >FitnessBrowser__Cola:Echvi_2919 Length = 393 Score = 201 bits (512), Expect = 2e-56 Identities = 122/380 (32%), Positives = 198/380 (52%), Gaps = 23/380 (6%) Query: 30 KGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTS--NVFTNEPAL 87 K +G ++ +G++YID GI V+ +GH HP +++A++ Q + H + P Sbjct: 25 KAEGIYMYGPKGEKYIDLISGIGVSNVGHRHPKVLKAIQDQLDKYMHLMVYGEYVQSPQT 84 Query: 88 RLGRKLIDAT--FAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRS 145 +L + L D + V +NSG+EA E A KLA+ Y R +I++ NA+HG S Sbjct: 85 QLAKALTDTLPKKLDNVYLVNSGSEAVEGALKLAKRYTGRR------EILSCVNAYHGSS 138 Query: 146 LFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVQAAT 205 +SVGG + + P I H+ FN+ + + ++ T A++VE +QGE G++ T Sbjct: 139 HGALSVGGNEIFKRAYRPLLPGIRHLDFNEPDQLDQITEE-TAAIMVETVQGEAGIRVGT 197 Query: 206 PEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSA 265 E+ K LR CDE LL+ DE+Q G GRTG +A+ HY + PDI+ AK +GGG P+ A Sbjct: 198 KEYFKALRHRCDETGTLLILDEIQAGFGRTGKFWAFQHYDIVPDIVVCAKGMGGGMPIGA 257 Query: 266 MLTTQEIASAFH---VGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHL 322 + Q I S F + H +T+GG+P++CA A A DI+ +++Q + K F +HL Sbjct: 258 FIAPQSIMSVFKNNPLLGHITTFGGHPVSCAAALATIDILRDEKLIQHVERKANLFKKHL 317 Query: 323 QAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMV--LNAGADVMRFAP 380 Q +IR GL++ + + + + E G++ D MR AP Sbjct: 318 NHPKIQ-----EIRNKGLMMAVKFEAFEV--LKPIIDRAIELGIITDWFLFCEDSMRIAP 370 Query: 381 SLVVEEADIHEGMQRFAQAV 400 L + + +I + Q++ Sbjct: 371 PLTITDEEIEKACAIILQSI 390 Lambda K H 0.322 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 393 Length adjustment: 31 Effective length of query: 374 Effective length of database: 362 Effective search space: 135388 Effective search space used: 135388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory