Align Glutamate 5-kinase; EC 2.7.2.11; Gamma-glutamyl kinase; GK (uncharacterized)
to candidate Echvi_2634 Echvi_2634 glutamate 5-kinase
Query= curated2:Q3IP73 (284 letters) >FitnessBrowser__Cola:Echvi_2634 Length = 268 Score = 152 bits (383), Expect = 1e-41 Identities = 94/253 (37%), Positives = 144/253 (56%), Gaps = 10/253 (3%) Query: 28 KRVVVKAGTNSLTDEESNLDDDKLDKLVDDIADLLERDKDVLLVSSGAVGAGI----GRV 83 KR+V+K GTN +T+ ++ + + L K+VD IA L ER +LVSSG+V AG +V Sbjct: 14 KRIVIKVGTNVMTNRDNRIVNTVLRKMVDQIAILYERGIMSVLVSSGSVIAGKEVLGSKV 73 Query: 84 GYGSRTVEESQALSTVGQSHLMRRYTESFERYDRKVAQILLTQQDLENPERFTNFCNTVE 143 G + + Q S VGQ +MR Y F+ Y + AQ+L T++D + + N N E Sbjct: 74 GIKDKIIRR-QVFSAVGQPRMMRHYYNIFQDYGMRCAQVLATKRDFDPGKHRENMINCYE 132 Query: 144 TLLEWDIVPIINENDAVATQEIRIGDNDMLSSSVAVGVDADLLVTLTDVDAVYTGNPKED 203 LL I+PI NE+DAV+ DND L+S VA AD+L+ LTD D +Y G+P +D Sbjct: 133 GLLSEGIIPIANEDDAVSLSMSTFTDNDELASLVAELTKADMLILLTDTDGLYNGHP-DD 191 Query: 204 PDAERIEAVGENYDQIQGLVEESSSSDF---GGIRTKVEGARNVSEYGIPAIIAGSAEPD 260 + ERI VG + ++++ ++ES+ + GG+++K+ A+ + IP IA + Sbjct: 192 ENTERIAHVGTD-EKVEHFIQESTKGEAEGRGGMKSKLNVAKEAARKNIPTYIANGNVDN 250 Query: 261 VLQQIATGKSVGT 273 ++ I GK VGT Sbjct: 251 MILDIVDGKEVGT 263 Lambda K H 0.310 0.130 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 268 Length adjustment: 25 Effective length of query: 259 Effective length of database: 243 Effective search space: 62937 Effective search space used: 62937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Echvi_2634 Echvi_2634 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.29806.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-68 216.1 0.9 4.5e-68 216.0 0.9 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2634 Echvi_2634 glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2634 Echvi_2634 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.0 0.9 4.5e-68 4.5e-68 1 252 [. 14 266 .. 14 268 .] 0.96 Alignments for each domain: == domain 1 score: 216.0 bits; conditional E-value: 4.5e-68 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglper.pkklaekQalaa 73 kriV+K+G++++t+ ++++ ++ l+++v q+a l + G v+vsSG+v aG e Lg + k+ +Q+ +a lcl|FitnessBrowser__Cola:Echvi_2634 14 KRIVIKVGTNVMTNRDNRIVNTVLRKMVDQIAILYERGIMSVLVSSGSVIAGKEVLGSKVGiKDKIIRRQVFSA 87 69*******************************************************9976156799******* PP TIGR01027 74 VGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDt 147 VGQ r+m++y ++f+ yg++ aQ+L t++d+ ++ +N n e ll+ g++pi NE D+v+ + +f DND+ lcl|FitnessBrowser__Cola:Echvi_2634 88 VGQPRMMRHYYNIFQDYGMRCAQVLATKRDFDPGKHRENMINCYEGLLSEGIIPIANEDDAVSLSMSTFTDNDE 161 ************************************************************************** PP TIGR01027 148 LsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagss.gssvGTGGmrtKleaaelA 220 L+ lva l +Ad+L+lltd dgLy+ p + + ++i +v e+ + ++ s+ g++ G GGm++Kl+ a+ A lcl|FitnessBrowser__Cola:Echvi_2634 162 LASLVAELTKADMLILLTDTDGLYNGHP-DDENTERIAHVGTDEKVEHFIQESTkGEAEGRGGMKSKLNVAKEA 234 ****************************.888999*****999998888887776888**************** PP TIGR01027 221 sragveviiasgekpekiadlledaavgtlfe 252 +r +++++ia+g+ + i+d++++++vgt++ lcl|FitnessBrowser__Cola:Echvi_2634 235 ARKNIPTYIANGNVDNMILDIVDGKEVGTKVS 266 *****************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory