GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Echinicola vietnamensis KMM 6221, DSM 17526

Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate Echvi_0713 Echvi_0713 aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)

Query= SwissProt::P23247
         (337 letters)



>FitnessBrowser__Cola:Echvi_0713
          Length = 329

 Score =  285 bits (730), Expect = 9e-82
 Identities = 161/330 (48%), Positives = 216/330 (65%), Gaps = 11/330 (3%)

Query: 7   VAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQ 66
           +A+ GATG VG  +LEVL E  FP DEL L+ASERS GK   F  K   V  + +    +
Sbjct: 3   LAVVGATGLVGSEILEVLAEHNFPFDELLLVASERSAGKKIAFKDKEYTVIGLAQAVSEK 62

Query: 67  VHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNI 126
             IA+FSAGG+ S +WAP  AEAG +V+DN+S +R D    LVVPE+N +++    +  I
Sbjct: 63  PDIAIFSAGGDTSKEWAPKFAEAGTIVVDNSSAWRMDPTKKLVVPEINAKSLK--IDDRI 120

Query: 127 IANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAE 186
           IANPNCSTIQM++AL  + D  GI+R+ V+TYQSV+G+G   +++L  + A    G   E
Sbjct: 121 IANPNCSTIQMVLALTKLRDRYGIKRVVVSTYQSVTGSGLKAVNQLQDERA----GKEGE 176

Query: 187 TNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHA 246
              +  +I  N +P ID F DNGYTKEEMKM+ ET+KIF DPSI V  T VR+PV  GH+
Sbjct: 177 -KAYPHKIDLNVLPHIDVFQDNGYTKEEMKMINETKKIFEDPSIQVTATTVRIPVMGGHS 235

Query: 247 EAVHVETRAPIDAEQVMDMLEQTDGIEL---FRGADFPTQVRDAGGKDHVLVGRVRNDIS 303
           E+V+VE +   D E+V ++L  T G+ +        +P  + +A  KD V VGR+R D S
Sbjct: 236 ESVNVEFKEDFDLEEVKELLAATPGVVVEDDVANNVYPMPM-NAHKKDEVFVGRLRRDES 294

Query: 304 HHSGINLWVVADNVRKGAATNAVQIAELLV 333
             + +N+W+VADN+RKGAATNAVQIAE LV
Sbjct: 295 QPNTLNMWIVADNLRKGAATNAVQIAEYLV 324


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 285
Number of extensions: 8
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 329
Length adjustment: 28
Effective length of query: 309
Effective length of database: 301
Effective search space:    93009
Effective search space used:    93009
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Echvi_0713 Echvi_0713 (aspartate-semialdehyde dehydrogenase (peptidoglycan organisms))
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.6770.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.6770.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.