Align anthranilate phosphoribosyltransferase (EC 2.4.2.18) (characterized)
to candidate Echvi_2507 Echvi_2507 anthranilate phosphoribosyltransferase
Query= reanno::Pedo557:CA265_RS05010 (329 letters) >FitnessBrowser__Cola:Echvi_2507 Length = 338 Score = 410 bits (1055), Expect = e-119 Identities = 201/327 (61%), Positives = 257/327 (78%) Query: 1 MKKILNHLFENKSFSREEAKNILISISEGAFNSSQIAAFITAYAMRNITVQELQGFRDAM 60 MK ILNHL E+++ +EEAK+ L I+ GA+N SQ+AAF+T Y MR+ITV+EL+GFR+AM Sbjct: 1 MKDILNHLIEHRTLGKEEAKSTLKKITSGAYNQSQMAAFMTVYMMRSITVEELEGFREAM 60 Query: 61 LDMCVKVNLSGYDLIDLCGTGGDGKDTFNISTLSSFVVAGAGHHVAKHGNYGVSSGCGSS 120 L+ C+ V + YD +DLCGTGGDGKDTFNISTLSSFVVAGAG +VAKHGN GVSS CGSS Sbjct: 61 LEQCIPVEIPEYDAMDLCGTGGDGKDTFNISTLSSFVVAGAGQNVAKHGNNGVSSICGSS 120 Query: 121 NVMEYLGYTFTNNEDTLKRNLDAAGICFLHAPLFNPAMKIVAPIRKELGVKTFFNMLGPM 180 N++ GY FTN+ + +++NLD AGICFLHAPLF+PAMK V PIRKELGVKTFFNMLGPM Sbjct: 121 NLLAQFGYNFTNDINVIRKNLDEAGICFLHAPLFHPAMKNVGPIRKELGVKTFFNMLGPM 180 Query: 181 VNPGQPKYQMVGVFSLELARLYAYLYQDTDKSYTIVHALEGYDEVSLTCDVKTFSNKGEQ 240 VNP PK Q+VGVFSLELARLY YLYQ++ ++I+H+L+GYDEVSLT D K SN GE+ Sbjct: 181 VNPSFPKKQLVGVFSLELARLYGYLYQNSRVDFSILHSLDGYDEVSLTGDFKMISNSGER 240 Query: 241 ILTLQDMGFDKVEVNAIKGGDTVESSAKIFMDVLNGKATDVQNNVVLCNSALAIKTIKPQ 300 +++ + +G +++ +I+GG T+E+SAKIF D+L G+ T+ Q VVL NSA A+ T Sbjct: 241 LISPESIGLPRLDAKSIEGGKTIEASAKIFQDILKGEGTEAQRAVVLANSAAALVTADQS 300 Query: 301 QSFADCFYEAEESLMSKKALNSFKQLL 327 SF + +A ESL S KAL +FK+L+ Sbjct: 301 LSFEEGIVKAAESLDSGKALQTFKKLV 327 Lambda K H 0.319 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 338 Length adjustment: 28 Effective length of query: 301 Effective length of database: 310 Effective search space: 93310 Effective search space used: 93310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Echvi_2507 Echvi_2507 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.30577.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-100 321.0 0.1 5.4e-100 320.8 0.1 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2507 Echvi_2507 anthranilate phosphor Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2507 Echvi_2507 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.8 0.1 5.4e-100 5.4e-100 1 329 [. 5 328 .. 5 329 .. 0.98 Alignments for each domain: == domain 1 score: 320.8 bits; conditional E-value: 5.4e-100 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDi 74 l++l+++++L +eea++ +k+i sg ++++q+aA++++ +++ t+ee++g+ +a++e+ ve ++++++D lcl|FitnessBrowser__Cola:Echvi_2507 5 LNHLIEHRTLGKEEAKSTLKKITSGAYNQSQMAAFMTVYMMRSITVEELEGFREAMLEQCIPVEI-PEYDAMDL 77 5789***********************************************************99.7******* PP TIGR01245 75 vGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfA 148 +GTGGDg +t+NiST s++v+a+aG +vaKhGn vss +Gs+++L ++g+n+ ++++ +++ l+e gi+Fl+A lcl|FitnessBrowser__Cola:Echvi_2507 78 CGTGGDGKDTFNISTLSSFVVAGAGQNVAKHGNNGVSSICGSSNLLAQFGYNFTNDINVIRKNLDEAGICFLHA 151 ************************************************************************** PP TIGR01245 149 PkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDE 222 P +hpa+k+v p+RkeLgv+t fN+LGP++nP +k q++Gv+s +l++++ +n +v+ ++h+ dg DE lcl|FitnessBrowser__Cola:Echvi_2507 152 PLFHPAMKNVGPIRKELGVKTFFNMLGPMVNPSFPKKQLVGVFSLELARLYGYLYQNSRVD-FSILHSLDGYDE 224 ************************************************************9.899********* PP TIGR01245 223 isltgetkvaelkdgeieeytlspedfglkraeleelkggsa.eenaellkevlegkekkakrdivvlNaaaal 295 +sltg+ k+++ + e +spe++gl+r + ++++gg++ e++a++++++l+g++++a+r++v++N aaal lcl|FitnessBrowser__Cola:Echvi_2507 225 VSLTGDFKMISNS----GERLISPESIGLPRLDAKSIEGGKTiEASAKIFQDILKGEGTEAQRAVVLANSAAAL 294 *******999877....46679*****************999899***************************** PP TIGR01245 296 yvagkakdlkegvelakeaiksgkalekleelva 329 ++a++ +++eg+ a e+++sgkal+++++lv+ lcl|FitnessBrowser__Cola:Echvi_2507 295 VTADQSLSFEEGIVKAAESLDSGKALQTFKKLVN 328 ******************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.42 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory