Align amino-acid acetyltransferase (characterized)
to candidate RR42_RS13035 RR42_RS13035 amino acid acetyltransferase
Query= CharProtDB::CH_024150 (443 letters) >FitnessBrowser__Cup4G11:RR42_RS13035 Length = 478 Score = 389 bits (998), Expect = e-112 Identities = 197/435 (45%), Positives = 283/435 (65%), Gaps = 4/435 (0%) Query: 8 ELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLVVVYGARP 67 + V+ R PYI+ RGKTFVI GGE ++ ++VND+ LLH++G+++V+V+G+RP Sbjct: 48 QFVDWLRAVAPYIHAFRGKTFVIAFGGELVKANILDALVNDVALLHAMGMQIVLVHGSRP 107 Query: 68 QIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTPLQGAHIN 127 Q++ LA H E + +RVTD LE K+AAG L+LDI A S L NTP+ GA ++ Sbjct: 108 QVEEQLALRHVESQFADGVRVTDNAALECAKEAAGELRLDIEAAFSQGLPNTPMAGAQLS 167 Query: 128 VVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNL 187 V+SGNF+ A+PLG+ DGVDY H+G +R+ID +++ L G IVL+ P+ S TG++FNL Sbjct: 168 VISGNFVTARPLGIVDGVDYQHTGLVRKIDGESVRMSLSHGKIVLLSPLGFSPTGQAFNL 227 Query: 188 TSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYNSGT 247 + E++A+ AI LKA+K++ GV + G ++ E+ A R++ D + Sbjct: 228 SMEDVASATAIALKADKLVFITEVPGVQDPVGKLMPEMSLRTAIERLQNNHLPPDVS--- 284 Query: 248 VRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIG 307 +L VKA + GV R HLI +Q DG++L ELF DG+GT I E +R AT++D+G Sbjct: 285 -YYLEHLVKALKGGVPRAHLIPFQLDGSVLLELFLHDGVGTMISDTDLESLREATLDDVG 343 Query: 308 GILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVA 367 GIL+LI PLEQ G LV R R +E +I F++I+ D CAALY +P E + EMAC+ Sbjct: 344 GILQLIAPLEQDGTLVPRGRHLIERDIANFSVIEHDGVLFGCAALYAYPREGMAEMACLT 403 Query: 368 VHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQ 427 V + + + GE LL+RI +A+ GL +LFVLTTR+ HWF +RGF ++D LPE K++ Sbjct: 404 VSSEAQGTGDGERLLKRIERRARSLGLDRLFVLTTRTEHWFLKRGFVHANVDDLPEDKRK 463 Query: 428 LYNYQRKSKVLMADL 442 LYN+QRKS VLM L Sbjct: 464 LYNWQRKSMVLMKKL 478 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 478 Length adjustment: 33 Effective length of query: 410 Effective length of database: 445 Effective search space: 182450 Effective search space used: 182450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS13035 RR42_RS13035 (amino acid acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.14736.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-207 674.2 0.0 4.7e-207 674.0 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS13035 RR42_RS13035 amino acid acetyltr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS13035 RR42_RS13035 amino acid acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 674.0 0.0 4.7e-207 4.7e-207 1 429 [] 49 478 .] 49 478 .] 0.99 Alignments for each domain: == domain 1 score: 674.0 bits; conditional E-value: 4.7e-207 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrg 69 fv+wlr++aPyi+a+r+kt+v+++ggelv+++ l++lv+d+allh++G+++vlvhG+rpq+ee+la r+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 49 FVDWLRAVAPYIHAFRGKTFVIAFGGELVKANILDALVNDVALLHAMGMQIVLVHGSRPQVEEQLALRH 117 8******************************************************************** PP TIGR01890 70 rtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvd 138 +++++ +G+rvtd+a+le++keaaGelrl+iea++s+ l+ntpmag++lsv+sGnfvtarP+G+v+Gvd lcl|FitnessBrowser__Cup4G11:RR42_RS13035 118 VESQFADGVRVTDNAALECAKEAAGELRLDIEAAFSQGLPNTPMAGAQLSVISGNFVTARPLGIVDGVD 186 ********************************************************************* PP TIGR01890 139 yehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGil 207 y+htG vrkid e++r +l++++ivllsPlgfs+tG++fnl+medva+ +ai+lkadkl+++te++G+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 187 YQHTGLVRKIDGESVRMSLSHGKIVLLSPLGFSPTGQAFNLSMEDVASATAIALKADKLVFITEVPGVQ 255 ********************************************************************* PP TIGR01890 208 dadGklvaelsaqeveslverleeet....tarllsaavkalrgGvarshlvsyaedGallqelftrdG 272 d++Gkl+ e+s +++++erl+++ +++l++ vkal+gGv+r+hl++++ dG++l+elf++dG lcl|FitnessBrowser__Cup4G11:RR42_RS13035 256 DPVGKLMPEMS---LRTAIERLQNNHlppdVSYYLEHLVKALKGGVPRAHLIPFQLDGSVLLELFLHDG 321 **********9...888999999988888889************************************* PP TIGR01890 273 iGtlvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalyp 341 +Gt++s ++les+reat+ddvggil+li Ple++G+lv+r r+l+er+i++fsvie+dG+++gcaaly+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 322 VGTMISDTDLESLREATLDDVGGILQLIAPLEQDGTLVPRGRHLIERDIANFSVIEHDGVLFGCAALYA 390 ********************************************************************* PP TIGR01890 342 yaeeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPe 410 y+ e+++e+acl+vs ea+++g+Gerllk+ie rar++Gl rlfvlttrtehWf++rGf++a+vd+lPe lcl|FitnessBrowser__Cup4G11:RR42_RS13035 391 YPREGMAEMACLTVSSEAQGTGDGERLLKRIERRARSLGLDRLFVLTTRTEHWFLKRGFVHANVDDLPE 459 ********************************************************************* PP TIGR01890 411 arrklynyqrrskilvkkl 429 ++rklyn+qr+s++l+kkl lcl|FitnessBrowser__Cup4G11:RR42_RS13035 460 DKRKLYNWQRKSMVLMKKL 478 *****************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (478 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.40 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory