Align amino-acid acetyltransferase (characterized)
to candidate RR42_RS13035 RR42_RS13035 amino acid acetyltransferase
Query= CharProtDB::CH_024150 (443 letters) >FitnessBrowser__Cup4G11:RR42_RS13035 Length = 478 Score = 389 bits (998), Expect = e-112 Identities = 197/435 (45%), Positives = 283/435 (65%), Gaps = 4/435 (0%) Query: 8 ELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLVVVYGARP 67 + V+ R PYI+ RGKTFVI GGE ++ ++VND+ LLH++G+++V+V+G+RP Sbjct: 48 QFVDWLRAVAPYIHAFRGKTFVIAFGGELVKANILDALVNDVALLHAMGMQIVLVHGSRP 107 Query: 68 QIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTPLQGAHIN 127 Q++ LA H E + +RVTD LE K+AAG L+LDI A S L NTP+ GA ++ Sbjct: 108 QVEEQLALRHVESQFADGVRVTDNAALECAKEAAGELRLDIEAAFSQGLPNTPMAGAQLS 167 Query: 128 VVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNL 187 V+SGNF+ A+PLG+ DGVDY H+G +R+ID +++ L G IVL+ P+ S TG++FNL Sbjct: 168 VISGNFVTARPLGIVDGVDYQHTGLVRKIDGESVRMSLSHGKIVLLSPLGFSPTGQAFNL 227 Query: 188 TSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYNSGT 247 + E++A+ AI LKA+K++ GV + G ++ E+ A R++ D + Sbjct: 228 SMEDVASATAIALKADKLVFITEVPGVQDPVGKLMPEMSLRTAIERLQNNHLPPDVS--- 284 Query: 248 VRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIG 307 +L VKA + GV R HLI +Q DG++L ELF DG+GT I E +R AT++D+G Sbjct: 285 -YYLEHLVKALKGGVPRAHLIPFQLDGSVLLELFLHDGVGTMISDTDLESLREATLDDVG 343 Query: 308 GILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVA 367 GIL+LI PLEQ G LV R R +E +I F++I+ D CAALY +P E + EMAC+ Sbjct: 344 GILQLIAPLEQDGTLVPRGRHLIERDIANFSVIEHDGVLFGCAALYAYPREGMAEMACLT 403 Query: 368 VHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQ 427 V + + + GE LL+RI +A+ GL +LFVLTTR+ HWF +RGF ++D LPE K++ Sbjct: 404 VSSEAQGTGDGERLLKRIERRARSLGLDRLFVLTTRTEHWFLKRGFVHANVDDLPEDKRK 463 Query: 428 LYNYQRKSKVLMADL 442 LYN+QRKS VLM L Sbjct: 464 LYNWQRKSMVLMKKL 478 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 478 Length adjustment: 33 Effective length of query: 410 Effective length of database: 445 Effective search space: 182450 Effective search space used: 182450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS13035 RR42_RS13035 (amino acid acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.30459.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-207 674.2 0.0 4.7e-207 674.0 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS13035 RR42_RS13035 amino acid acetyltr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS13035 RR42_RS13035 amino acid acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 674.0 0.0 4.7e-207 4.7e-207 1 429 [] 49 478 .] 49 478 .] 0.99 Alignments for each domain: == domain 1 score: 674.0 bits; conditional E-value: 4.7e-207 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrg 69 fv+wlr++aPyi+a+r+kt+v+++ggelv+++ l++lv+d+allh++G+++vlvhG+rpq+ee+la r+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 49 FVDWLRAVAPYIHAFRGKTFVIAFGGELVKANILDALVNDVALLHAMGMQIVLVHGSRPQVEEQLALRH 117 8******************************************************************** PP TIGR01890 70 rtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvd 138 +++++ +G+rvtd+a+le++keaaGelrl+iea++s+ l+ntpmag++lsv+sGnfvtarP+G+v+Gvd lcl|FitnessBrowser__Cup4G11:RR42_RS13035 118 VESQFADGVRVTDNAALECAKEAAGELRLDIEAAFSQGLPNTPMAGAQLSVISGNFVTARPLGIVDGVD 186 ********************************************************************* PP TIGR01890 139 yehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGil 207 y+htG vrkid e++r +l++++ivllsPlgfs+tG++fnl+medva+ +ai+lkadkl+++te++G+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 187 YQHTGLVRKIDGESVRMSLSHGKIVLLSPLGFSPTGQAFNLSMEDVASATAIALKADKLVFITEVPGVQ 255 ********************************************************************* PP TIGR01890 208 dadGklvaelsaqeveslverleeet....tarllsaavkalrgGvarshlvsyaedGallqelftrdG 272 d++Gkl+ e+s +++++erl+++ +++l++ vkal+gGv+r+hl++++ dG++l+elf++dG lcl|FitnessBrowser__Cup4G11:RR42_RS13035 256 DPVGKLMPEMS---LRTAIERLQNNHlppdVSYYLEHLVKALKGGVPRAHLIPFQLDGSVLLELFLHDG 321 **********9...888999999988888889************************************* PP TIGR01890 273 iGtlvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalyp 341 +Gt++s ++les+reat+ddvggil+li Ple++G+lv+r r+l+er+i++fsvie+dG+++gcaaly+ lcl|FitnessBrowser__Cup4G11:RR42_RS13035 322 VGTMISDTDLESLREATLDDVGGILQLIAPLEQDGTLVPRGRHLIERDIANFSVIEHDGVLFGCAALYA 390 ********************************************************************* PP TIGR01890 342 yaeeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPe 410 y+ e+++e+acl+vs ea+++g+Gerllk+ie rar++Gl rlfvlttrtehWf++rGf++a+vd+lPe lcl|FitnessBrowser__Cup4G11:RR42_RS13035 391 YPREGMAEMACLTVSSEAQGTGDGERLLKRIERRARSLGLDRLFVLTTRTEHWFLKRGFVHANVDDLPE 459 ********************************************************************* PP TIGR01890 411 arrklynyqrrskilvkkl 429 ++rklyn+qr+s++l+kkl lcl|FitnessBrowser__Cup4G11:RR42_RS13035 460 DKRKLYNWQRKSMVLMKKL 478 *****************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (478 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.58 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory