Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate RR42_RS17170 RR42_RS17170 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__Cup4G11:RR42_RS17170 Length = 409 Score = 490 bits (1261), Expect = e-143 Identities = 242/401 (60%), Positives = 303/401 (75%), Gaps = 6/401 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIAL-- 59 K+VLAYSGGLDTS+ILKWL++TY+ EV+ FTADIGQGEE+E AR+KAL+ G Sbjct: 6 KVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADIGQGEELEPARQKALKFGIKPENIFID 65 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DL+EEFVRDFVFPM RA AVYEG YLLGTSIARPLIAK + I GA+A++HGATGKG Sbjct: 66 DLREEFVRDFVFPMFRANAVYEGEYLLGTSIARPLIAKRQIEILRSTGADAVSHGATGKG 125 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK---PYSMDA 176 NDQVRFEL Y L+P +KVIAPWREW R++++AYAE GI + + +K PYSMDA Sbjct: 126 NDQVRFELGYYGLEPGVKVIAPWREWDLLSREKLLAYAEKAGIDIDMKHKKGGAPYSMDA 185 Query: 177 NLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPA 236 NLLHIS+EG LEDP AE + M+R T PE APDA EY++VEF GD V +NG+R++PA Sbjct: 186 NLLHISFEGRHLEDPKAEAEEDMWRWTVSPENAPDAAEYLDVEFEGGDIVGLNGKRMTPA 245 Query: 237 ALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLH 296 +L LN +GG+HG+GR+D+VENR+VGMKSRG YETPGGTI+ A RA+ES+TLDREV H Sbjct: 246 EVLTELNRLGGKHGIGRLDLVENRYVGMKSRGCYETPGGTIILKAHRAIESITLDREVAH 305 Query: 297 QRDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKS 356 +D L P+YA L+Y G+W++PER ALQ DH V G R+KLYKGNV VV R + + Sbjct: 306 LKDDLMPRYASLIYNGYWWSPERRALQVLIDHTQAKVNGWVRVKLYKGNVIVVARDSKDT 365 Query: 357 LYRQDLVSFDEAGG-YDQKDAEGFIKIQALRLRVRALVERE 396 L+ + + +FD+ GG Y+Q DA GFIK+ ALR+R+ R+ Sbjct: 366 LFDKTIATFDDDGGAYNQADAGGFIKLNALRMRIAENARRQ 406 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 409 Length adjustment: 31 Effective length of query: 369 Effective length of database: 378 Effective search space: 139482 Effective search space used: 139482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS17170 RR42_RS17170 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.25447.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-145 468.8 0.0 1.1e-144 468.5 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS17170 RR42_RS17170 argininosuccinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS17170 RR42_RS17170 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.5 0.0 1.1e-144 1.1e-144 1 390 [. 6 401 .. 6 405 .. 0.96 Alignments for each domain: == domain 1 score: 468.5 bits; conditional E-value: 1.1e-144 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGae..kayviDareefvk 66 kvvlaysGGlDtsv+lk+l++ +ev+++t+d+Gq+ e+l+ +++kalk+G + + + D reefv+ lcl|FitnessBrowser__Cup4G11:RR42_RS17170 6 KVVLAYSGGLDTSVILKWLQDTyQCEVVTFTADIGQG-EELEPARQKALKFGIKpeNIFIDDLREEFVR 73 8*********************899***********9.9*************86314555579****** PP TIGR00032 67 dylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdl 135 d++f+ +anavyeg+Yll+t++aRpliak+++e+ + ga+av+hG+tgKGnDqvRFel + l+p + lcl|FitnessBrowser__Cup4G11:RR42_RS17170 74 DFVFPMFRANAVYEGEYLLGTSIARPLIAKRQIEILRSTGADAVSHGATGKGNDQVRFELGYYGLEPGV 142 ********************************************************************* PP TIGR00032 136 kviaPvreleli.ReeeieyaaekGievpvekek...aysiDenllgrsiEageLEdpsteppediyel 200 kviaP+re++l Re++++ya++ Gi++ ++++k +ys+D nll++s E+ +LEdp++e ed++++ lcl|FitnessBrowser__Cup4G11:RR42_RS17170 143 KVIAPWREWDLLsREKLLAYAEKAGIDIDMKHKKggaPYSMDANLLHISFEGRHLEDPKAEAEEDMWRW 211 **********987*****************99876669******************************* PP TIGR00032 201 vkdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiY 269 +++p++++ d +e++++eFe G v lng++++p e++ ++n+++gkhG+Gr+D vE+R++g+KsR++Y lcl|FitnessBrowser__Cup4G11:RR42_RS17170 212 TVSPENAP-DAAEYLDVEFEGGDIVGLNGKRMTPAEVLTELNRLGGKHGIGRLDLVENRYVGMKSRGCY 279 **998888.************************************************************ PP TIGR00032 270 EapalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrv 338 E+p+ ++++kAh+++e+ +l+++v+++k+ +y+ liY+G+w++p++ al+ li++tq +v+G+vrv lcl|FitnessBrowser__Cup4G11:RR42_RS17170 280 ETPGGTIILKAHRAIESITLDREVAHLKDDLMPRYASLIYNGYWWSPERRALQVLIDHTQAKVNGWVRV 348 ********************************************************************* PP TIGR00032 339 klfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvyr 390 kl+kGn+iv++r+s+++l+d+++++f+ +++q da Gfik+++l++++ + lcl|FitnessBrowser__Cup4G11:RR42_RS17170 349 KLYKGNVIVVARDSKDTLFDKTIATFDDdGGAYNQADAGGFIKLNALRMRIAE 401 ***************************8446799*************998766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (409 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.82 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory