Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate RR42_RS17645 RR42_RS17645 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >FitnessBrowser__Cup4G11:RR42_RS17645 Length = 291 Score = 276 bits (705), Expect = 5e-79 Identities = 155/281 (55%), Positives = 192/281 (68%), Gaps = 14/281 (4%) Query: 2 DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGG-NVT 60 D+YVV GNPI HS+SP IH FA+QTG+ +EY LLAPLD F R FF G G NVT Sbjct: 8 DRYVVIGNPIAHSRSPAIHAAFAQQTGEAVEYERLLAPLDGFVATVRAFFDGGGHGLNVT 67 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFK EA+ L + LTPRA AGAVNT+ + DG + GDNTDG GL RD+ VN L GK Sbjct: 68 VPFKLEAYDLAERLTPRAESAGAVNTMW-IEDGVIHGDNTDGVGLTRDIEVNLDTLLEGK 126 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKA----EQLAREFDELG-PVVASGFA 175 RIL+LGAGGA G + P++A +P+ +V+ANRT ++A E +A++ DE G + GF Sbjct: 127 RILLLGAGGAAMGAMLPLIACRPERIVVANRTPQRASDILENVAQQADEYGVELWGGGFD 186 Query: 176 WL-----QEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKL 230 L ++ DV+INATS+SL GELPP+ L+ G + YDMMYG EPT F ++A + Sbjct: 187 ALAGLTDEDACDVVINATSSSLQGELPPVPAELLGKG-VLAYDMMYGAEPTVFLKFAAQC 245 Query: 231 GAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQL 271 G A+ DGLGML EQAAEAF+ WRGVRP TAPVLA LR L Sbjct: 246 G-ARTSDGLGMLVEQAAEAFYNWRGVRPATAPVLATLRAAL 285 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 291 Length adjustment: 26 Effective length of query: 248 Effective length of database: 265 Effective search space: 65720 Effective search space used: 65720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS17645 RR42_RS17645 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.21755.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-78 248.7 0.0 3.5e-78 248.5 0.0 1.1 1 lcl|FitnessBrowser__Cup4G11:RR42_RS17645 RR42_RS17645 shikimate dehydroge Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS17645 RR42_RS17645 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 248.5 0.0 3.5e-78 3.5e-78 3 269 .. 10 285 .. 8 286 .. 0.93 Alignments for each domain: == domain 1 score: 248.5 bits; conditional E-value: 3.5e-78 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlell 71 + viGnpi+hS sp+ih a+++q+g ++eY ++ ++++ + ++ +++ g +G+nvTvPfK e+++l+ lcl|FitnessBrowser__Cup4G11:RR42_RS17645 10 YVVIGNPIAHSRSPAIHAAFAQQTGEAVEYERLLAPLDGFVATVRAFFDGGGHGLNVTVPFKLEAYDLA 78 78******************************************************************* PP TIGR00507 72 DeieesakligavNTlkledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka 139 ++++++a+ +gavNT+ +edg + g+nTDg+Gl+ ++e l++l ++kr+l++GAGGaa +++l+L lcl|FitnessBrowser__Cup4G11:RR42_RS17645 79 ERLTPRAESAGAVNTMWIEDGVIHGDNTDGVGLTRDIEVnLDTLLEGKRILLLGAGGAAMGAMLPLIAC 147 **************************************99**************************998 PP TIGR00507 140 .dkeviiaNRtvekaeelaerlqe..........lgeilalsleevelkkvdliinatsaglsgeidea 197 ++++++aNRt ++a +++e +++ g al +++ d++inats++l+ge+ + lcl|FitnessBrowser__Cup4G11:RR42_RS17645 148 rPERIVVANRTPQRASDILENVAQqadeygvelwGGGFDALA-GLTDEDACDVVINATSSSLQGEL--P 213 799*****************9999777744443212222222.3346667****************..* PP TIGR00507 198 evkaellkegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealk 266 +v+aell +g l++D++y t++lk a + g++++dGlgMlv+Qaa +F w+gv p v +l+ lcl|FitnessBrowser__Cup4G11:RR42_RS17645 214 PVPAELLGKGVLAYDMMYGAEPTVFLKFAAQCGARTSDGLGMLVEQAAEAFYNWRGVRPATAPVLATLR 282 ************************************************************999999888 PP TIGR00507 267 ekl 269 ++l lcl|FitnessBrowser__Cup4G11:RR42_RS17645 283 AAL 285 877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.18 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory