Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate RR42_RS05860 RR42_RS05860 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::C3TIE2 (350 letters) >FitnessBrowser__Cup4G11:RR42_RS05860 Length = 359 Score = 468 bits (1204), Expect = e-136 Identities = 230/347 (66%), Positives = 279/347 (80%), Gaps = 3/347 (0%) Query: 6 DDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHD 65 DDLRI+E+KELLPP L+ +F +E A++ + AR+++H+IL G DDRL+V+IGPCSIHD Sbjct: 6 DDLRIRELKELLPPAHLIREFGCSEKASDVIYGARQSMHRILHGMDDRLIVIIGPCSIHD 65 Query: 66 PVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRI 125 AA EYA L R+ ELE+VMRVYFEKPRTTVGWKGLINDPHMD SF+INDGLR Sbjct: 66 TRAALEYAKLLKVQRDRFAGELEVVMRVYFEKPRTTVGWKGLINDPHMDGSFKINDGLRT 125 Query: 126 ARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGF 185 AR+LLL+I++ G+P E+LDMI+PQY+ADL+SWGAIGARTTESQVHRELASGLSCPVGF Sbjct: 126 ARELLLNISELGVPTGTEYLDMISPQYIADLVSWGAIGARTTESQVHRELASGLSCPVGF 185 Query: 186 KNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKH 245 KNGTDG +K+A+DAI AA PH FLSVTK GHSAIV+TSGN DCHIILRGGK PNY A Sbjct: 186 KNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIVSTSGNEDCHIILRGGKTPNYDAAS 245 Query: 246 VAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHL 305 V E E ++KAGL A++MID SHANSSK+ + Q+ VC D+ +Q+A G++ I+GVMVESHL Sbjct: 246 VQEACEAISKAGLAARLMIDASHANSSKKHENQIPVCEDIGRQMAAGDERIVGVMVESHL 305 Query: 306 VEGNQSLESGEP---LAYGKSITDACIGWEDTDALLRQLANAVKARR 349 V G Q G P L YG+S+TDACIGW+D+ +L LA+AVKARR Sbjct: 306 VGGRQDHAQGTPVEDLTYGQSVTDACIGWDDSVKVLETLASAVKARR 352 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 359 Length adjustment: 29 Effective length of query: 321 Effective length of database: 330 Effective search space: 105930 Effective search space used: 105930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS05860 RR42_RS05860 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.25103.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-166 538.9 0.0 2.2e-166 538.7 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS05860 RR42_RS05860 phospho-2-dehydro-3 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS05860 RR42_RS05860 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 538.7 0.0 2.2e-166 2.2e-166 1 342 [] 6 352 .. 6 352 .. 0.98 Alignments for each domain: == domain 1 score: 538.7 bits; conditional E-value: 2.2e-166 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyak 69 ddlri +++ell+P++l+++f +eka + + +r+++++il+G ddrl+v+iGPcsihd +aaleyak lcl|FitnessBrowser__Cup4G11:RR42_RS05860 6 DDLRIRELKELLPPAHLIREFGCSEKASDVIYGARQSMHRILHGMDDRLIVIIGPCSIHDTRAALEYAK 74 799****************************************************************** PP TIGR00034 70 rlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 lk ++++ +le+vmrvyfekPrttvGWkGlindP++++sf++n+Glr ar+lll++ elg+p++te lcl|FitnessBrowser__Cup4G11:RR42_RS05860 75 LLKVQRDRFAGELEVVMRVYFEKPRTTVGWKGLINDPHMDGSFKINDGLRTARELLLNISELGVPTGTE 143 ********************************************************************* PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsv 207 +ld+ispqy+adl+swgaiGarttesqvhrelasgls+pvgfkngtdG++k+a+dai+aa+++h+flsv lcl|FitnessBrowser__Cup4G11:RR42_RS05860 144 YLDMISPQYIADLVSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSV 212 ********************************************************************* PP TIGR00034 208 tkaGqvaivetkGnedghiilrGGkkpnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlev 276 tk G++aiv+t+Gned+hiilrGGk+pnyda++v+e++e ++kagl ++lmid+sh+ns+k++++q+ v lcl|FitnessBrowser__Cup4G11:RR42_RS05860 213 TKGGHSAIVSTSGNEDCHIILRGGKTPNYDAASVQEACEAISKAGLAARLMIDASHANSSKKHENQIPV 281 ********************************************************************* PP TIGR00034 277 aesvveqiaeGekaiiGvmiesnleeGnqslk.....eelkyGksvtdacigwedteallrklaeavke 340 +e++ +q+a G++ i+Gvm+es+l++G+q+ e+l+yG+svtdacigw+d+ ++l+ la+avk+ lcl|FitnessBrowser__Cup4G11:RR42_RS05860 282 CEDIGRQMAAGDERIVGVMVESHLVGGRQDHAqgtpvEDLTYGQSVTDACIGWDDSVKVLETLASAVKA 350 *****************************98512233579****************************9 PP TIGR00034 341 rr 342 rr lcl|FitnessBrowser__Cup4G11:RR42_RS05860 351 RR 352 96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.33 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory