Align Putative cystathionine gamma-lyase; EC 4.4.1.1; Gamma-cystathionase (uncharacterized)
to candidate RR42_RS30610 RR42_RS30610 cystathionine beta-lyase
Query= curated2:Q59829 (392 letters) >FitnessBrowser__Cup4G11:RR42_RS30610 Length = 405 Score = 181 bits (460), Expect = 3e-50 Identities = 125/339 (36%), Positives = 179/339 (52%), Gaps = 18/339 (5%) Query: 61 YTYGRDENPTWTRLESAIGELEAPGEAGVETLVFASGMAAISSVLFSQLRAGDTAVLPDD 120 +TYG NPT LE + ELEA G T +F SG+AA + L + LR G +LPD Sbjct: 55 FTYGARGNPTAFALEDMVTELEA----GYRTRLFPSGLAAAAMTLLAYLRPGQHVLLPDC 110 Query: 121 GYQAL-PLVRAQLEAYGIEVRT-APTGRDAQLDVLDGAKLLWIETPSNPGLDVCDVRRLV 178 Y+ + L L +GI A G D Q + +L+++E P + ++CD+ + Sbjct: 111 VYEPVRKLAEGFLAQHGIAASFYAADGHDLQARLRRETRLVYVEAPGSLAYEMCDLPAIA 170 Query: 179 EAAHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYVAGRDAG--A 236 + AH GALVA DNT + L +PL LGAD S+ + TK L+GH DV++G V +A A Sbjct: 171 DIAHRHGALVAADNTWGSGLLYQPLALGADISLMAATKYLSGHSDVMMGTVCTLEAAWPA 230 Query: 237 MAAVRRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYP 296 +AAV G P +A+L R + +L R+ + + +AL VA LRTRPE+ + P Sbjct: 231 LAAV---ADAFGISVSPDDAYLVQRGMRSLGARLSQHERSALAVAHWLRTRPEVAEVFCP 287 Query: 297 GLPDDPSHKVASQQMLRYGCVVSFTLPSRA--RADRFLDALRLVEGATSFGGVRSTAERR 354 LP DP H + + ++SF L + A A+RF+D+L L S+GG S A Sbjct: 288 ALPGDPGHALWQRDCHGTNGLLSFALRAVAPDAAERFIDSLALFGIGASWGGFESLAVIA 347 Query: 355 GRWGGDAVPE-----GFIRLSVGAEDPDDLVADLLRALD 388 G +V + IRL +G ED DDL+ADL R + Sbjct: 348 DMRGARSVTDWSGRGQVIRLHIGLEDVDDLLADLARGFE 386 Lambda K H 0.316 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 405 Length adjustment: 31 Effective length of query: 361 Effective length of database: 374 Effective search space: 135014 Effective search space used: 135014 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory