Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate RR42_RS10615 RR42_RS10615 2-hydroxyacid dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >FitnessBrowser__Cup4G11:RR42_RS10615 Length = 341 Score = 80.5 bits (197), Expect = 5e-20 Identities = 63/205 (30%), Positives = 94/205 (45%), Gaps = 14/205 (6%) Query: 74 VKPRQRRDYLLTNVRGIFGPLMSEYLFGYLLARQREHDLYKSQQQQ-KLWLPGSYKTLQG 132 V R L+T F P +SE+ G ++ R Y + + + P + L+G Sbjct: 89 VPAASRHGVLITQASAGFMPAVSEWAIGAMVDLARGTSRYAAAYHRGQPPAPVMGRELRG 148 Query: 133 SELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAK--ATEGFDEVATLEALPTLMARADAI 190 S L ++G G I ++L + A+ FGM++ + K A +V LP L+A AD + Sbjct: 149 SVLGVIGYGQIGRYLCELAQAFGMRIL-VTTPGKIPAQPALRQVP----LPQLLAEADFV 203 Query: 191 ASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALERQLRQHPQQQAVLDVFN 250 + P+ T ++N A MKPDA N RG+++D AL L LDV Sbjct: 204 VCVAPANAETENMMNAQAFAAMKPDAYFINASRGELVDEPALLHALESGHLGGCALDVGR 263 Query: 251 QEPLPEDHPIWGLG---NVIVTPHI 272 P+ P+ GL NVI TPHI Sbjct: 264 ---APDQMPVLGLARHPNVIATPHI 285 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 341 Length adjustment: 28 Effective length of query: 280 Effective length of database: 313 Effective search space: 87640 Effective search space used: 87640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory