Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate RR42_RS26540 RR42_RS26540 3-phosphoglycerate dehydrogenase
Query= BRENDA::H9JRZ9 (432 letters) >FitnessBrowser__Cup4G11:RR42_RS26540 Length = 311 Score = 186 bits (471), Expect = 1e-51 Identities = 106/264 (40%), Positives = 150/264 (56%), Gaps = 6/264 (2%) Query: 151 NHDALVVRSATQVTKEVLDAGVKLKVVGRAGAGVDNIDVDSAGKKGVGVINAPGANALSA 210 N ++VR VT E++DA LKV+ + G+G D ID +A +G+ V A GANA + Sbjct: 47 NPVGIIVRYGA-VTPEIMDAAPALKVISKHGSGTDTIDKPAAAARGIAVTAAVGANAAAV 105 Query: 211 CELTCTLMLVLARHVVPASTALKAGRWDRALYTGSELAGKTLAILGLGRVGREVATRMYA 270 E L+L A+ +V + + AG WD+A + ELAG+T+ ++GLG +GR A A Sbjct: 106 AEQAMALLLGCAKSLVQLNERMHAGHWDKATHKSVELAGRTIGLIGLGAIGRRFARMCDA 165 Query: 271 FGMNIIGFDPFVSADQCAQFHCTKMELEDIWPLADYITLHTPLIESTRNFINADVLKQCK 330 GM +IGFDPF +AD + ++L+ IW AD I+LH PL R INA L QCK Sbjct: 166 MGMRVIGFDPF-AAD--LPGYIEPVDLDAIWREADAISLHCPLTPGNRAMINAQTLAQCK 222 Query: 331 KGVKIINVGRGGLIQETDFLQALKSGKVGGAALDVFEQEPPTDPVTLEIIQQPAVIATPH 390 +GV ++N RGGLI E L A++SG+V A LD F EP T P QP + +PH Sbjct: 223 QGVILVNTARGGLIDEPALLAAVQSGQVAVAGLDSFAVEPMTVPHIFH--GQPGFLLSPH 280 Query: 391 LGASTKEAQVRVGQEIAEQLVNLV 414 +G T A V +G A+ + ++ Sbjct: 281 IGGVTSAAYVNMGVAAAQNTLGVL 304 Lambda K H 0.320 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 311 Length adjustment: 30 Effective length of query: 402 Effective length of database: 281 Effective search space: 112962 Effective search space used: 112962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory