Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate RR42_RS27010 RR42_RS27010 D-3-phosphoglycerate dehydrogenase
Query= BRENDA::C3SVM7 (410 letters) >FitnessBrowser__Cup4G11:RR42_RS27010 Length = 403 Score = 406 bits (1044), Expect = e-118 Identities = 214/372 (57%), Positives = 266/372 (71%), Gaps = 2/372 (0%) Query: 14 LLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLRSRTHLTEDVINAA 73 LL+E +H A+E + A T +E GAL ++L + +G+RS THL I AA Sbjct: 5 LLLENIHDTAVERFKEAHVT-VERRTGALAGDELHRAPAAHQILGIRSATHLGAAEIEAA 63 Query: 74 EKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAK 133 LVAIGCFCIGT+QVDLDAAA+ G+PVFNAPFSNTRSVAELVI E +LLLR VPE NA Sbjct: 64 RHLVAIGCFCIGTSQVDLDAAARAGMPVFNAPFSNTRSVAELVIAEAILLLRRVPEKNAL 123 Query: 134 AHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQ 193 AH G W K A+GSFEARGK + IIGYG+IG+Q+G+LAE++GM V +YD++ KL LG+A Sbjct: 124 AHAGKWAKGASGSFEARGKTIAIIGYGNIGSQVGVLAEAMGMRVVYYDVQAKLSLGSARA 183 Query: 194 VQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDAL 253 + L+D ++ +D+V+LHVP T+ M+ A + + G++LINASRGTVVDI AL A Sbjct: 184 ARSLADAVSQADIVTLHVPATAQTRKMIDADVLRQFRRGAILINASRGTVVDIEALRAAC 243 Query: 254 ASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLI 313 H+AG AIDVFP EP TN+D FTSPL N +LTPHIGGST+EAQENIG EVA KLI Sbjct: 244 DDNHIAGLAIDVFPEEPKTNADRFTSPLQGVPNAILTPHIGGSTEEAQENIGTEVATKLI 303 Query: 314 KYSDNGSTLSAVNFPEVSL-PLHGGRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQT 372 + G T+ AVNFPEVS PL RL+++H N PG L ALN + A GVNI AQ+LQT Sbjct: 304 AFLRTGDTIGAVNFPEVSPGPLTSPARLLNVHGNAPGALAALNTLLARDGVNIVAQHLQT 363 Query: 373 SAQMGYVVIDIE 384 QMGYVV D++ Sbjct: 364 HGQMGYVVTDLD 375 Lambda K H 0.318 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 403 Length adjustment: 31 Effective length of query: 379 Effective length of database: 372 Effective search space: 140988 Effective search space used: 140988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory