Align glutamyl-tRNA(Glx) synthetase (EC 6.1.1.24) (characterized)
to candidate RR42_RS14805 RR42_RS14805 glutamyl-Q tRNA(Asp) ligase
Query= reanno::Caulo:CCNA_01982 (470 letters) >FitnessBrowser__Cup4G11:RR42_RS14805 Length = 313 Score = 134 bits (337), Expect = 4e-36 Identities = 93/251 (37%), Positives = 128/251 (50%), Gaps = 9/251 (3%) Query: 12 RFAPSPTGFLHIGGARTALFNWLYARHTGGKFLIRVEDTDRERSTEAAVAAIFEGLDWLG 71 RFAPSPTG LH+G TAL +WL AR G +L+R+ED D R A I L LG Sbjct: 14 RFAPSPTGPLHMGSLVTALASWLDARAHLGSWLVRIEDIDYPRCVRGADQQILRALARLG 73 Query: 72 LKSDDEVIFQHTRAPRHVEVVHELLAKGRAYRCWMSIEELEVAREKARAEGRAIRSPW-- 129 L D+ +Q R + E + +L A Y C S +E+ + AR + + P Sbjct: 74 LHPDEPPQWQSRREALYAEALRQLDADHWTYPCGCSRKEIADSLLHARERHQTLGYPGTC 133 Query: 130 RDAPEGDLSAPHVIRFKGPLDGETLV---NDLVKG-PVTFKNIELDDLVLLRADGAPTYN 185 RD G P R + P DG+ + +D +G EL D VL RADG Y Sbjct: 134 RDGLHG--KPPRAWRVRVP-DGDAALICFDDRWQGRQCQDLATELGDFVLRRADGLWAYQ 190 Query: 186 LAVVVDDHDMGVTHVIRGDDHLNNAARQTLIYQAMDWAVPAFAHIPLIHGPDGAKLSKRH 245 LAVVVDD G+TH++RG D L++ RQ + + P++ H+P++ G KLSK+ Sbjct: 191 LAVVVDDGHQGITHIVRGADLLDSTPRQIHLQHLLGLPTPSYLHVPVVTNALGEKLSKQS 250 Query: 246 GAQAVGEFADL 256 GAQA+ + L Sbjct: 251 GAQAIDDLDPL 261 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 313 Length adjustment: 30 Effective length of query: 440 Effective length of database: 283 Effective search space: 124520 Effective search space used: 124520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory