Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate RR42_RS35305 RR42_RS35305 aspartate aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >FitnessBrowser__Cup4G11:RR42_RS35305 Length = 401 Score = 214 bits (546), Expect = 3e-60 Identities = 127/394 (32%), Positives = 197/394 (50%), Gaps = 13/394 (3%) Query: 1 MKLAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGH 60 + L L R+ + ++L A G+ +I L G+PDF+TP H+ +AA +A+ G Sbjct: 2 LSLTDRLNRIKPSPSSMAGQRVRELRAAGRDVIGLTAGEPDFETPAHIREAAWRAMQAGK 61 Query: 61 HGYVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHP 120 Y G E R A +K K+ D +++ G K ++ A+ C + G E+I P Sbjct: 62 TRYTDVGGTAELRHAAAQKFKRENGLDYAASEIIVSTGAKQVIFNALMCTVQQGDEVIVP 121 Query: 121 TPAFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFV 180 P + Y + + G PV + K PE++ I+ +TR LIL +PNNP+G+ Sbjct: 122 APYWVSYPDITLFAGGVPVFVACQAENGFKLTPEELERAISARTRWLILNSPNNPSGAAY 181 Query: 181 EKSAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFN-YPDLQDRLIVLDGWSKAY 239 ++ + +AE L++HPHV +++D+IY YDG T P L+ R + ++G SKAY Sbjct: 182 TRTELVAIAEVLERHPHVWVMTDDIYEHLTYDGAAFVTLAQAAPSLKARTLTINGVSKAY 241 Query: 240 AMTGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQR 299 AMTGWR+G++ P LI + KL S S NA +Q A IAALDGP D I F R Sbjct: 242 AMTGWRIGYAGAPAPLIKAMVKLQSQSTSGANAVAQAAAIAALDGPQDFIAANKAVFQAR 301 Query: 300 RKLIHEGLNSLPGVECSLPGGAFYAFPK---VIGTG-------MNGSEFAKKCMHEAGVA 349 R + L + G+ C P GAFY F +IG + ++ + +A Sbjct: 302 RDRVVAALGQVDGIHCQAPAGAFYVFASCEALIGARTPHGSVIRSSDDWVNWVLDSQDLA 361 Query: 350 IVPGTAFGKTCQDYVRFSYAASQDNISNALENIK 383 ++ G+A+G + R S+AAS + I+ Sbjct: 362 VLQGSAYG--VDTHFRLSFAASMAQLDEGCRRIE 393 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 401 Length adjustment: 31 Effective length of query: 356 Effective length of database: 370 Effective search space: 131720 Effective search space used: 131720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory