Align histidinol-phosphate aminotransferase; tyrosine/phenylalanine aminotransferase (promiscuous) (EC 2.6.1.1; EC 2.6.1.9) (characterized)
to candidate RR42_RS04465 RR42_RS04465 aspartate aminotransferase
Query= metacyc::BSU22620-MONOMER (360 letters) >FitnessBrowser__Cup4G11:RR42_RS04465 Length = 371 Score = 250 bits (639), Expect = 4e-71 Identities = 151/361 (41%), Positives = 202/361 (55%), Gaps = 6/361 (1%) Query: 5 EHLKQLKPYQPGKPIEAVKSEYGL--DKVVKLASNENPYGCSEAAKEALHHEIQQLALYP 62 E+++ + PY GKPI V E+GL +VKLASNENP G E+A+ A+ + L YP Sbjct: 11 EYVRAISPYVAGKPISEVAREFGLVESTIVKLASNENPLGMPESARTAIAAAVADLGRYP 70 Query: 63 DGYSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNA 122 D AL+ LS +V L GNGS++I++I A + + V A +F Y Sbjct: 71 DANGFALKGALSARFDVPPDWLTLGNGSNDILEIAAHALVKPGESIVYAEHSFAVYALAT 130 Query: 123 VIEGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVP 182 GA E+ R D HDLDAM AI T++V+I +PNNPTGT+ E+ FL +VP Sbjct: 131 QEVGARAIEVKAR-DYGHDLDAMAVAIAPDTRLVFIANPNNPTGTFLPAAEIETFLAKVP 189 Query: 183 SRVLVVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFSKAYGLAALRVGYGIADENLI 242 + V+VVLDEAY EY+ +++ + KY NL++ RTFSKAYGLA LR+GY +A L Sbjct: 190 ADVVVVLDEAYNEYLDDAQQYDSIAWVRKYPNLLVSRTFSKAYGLAGLRIGYAVAQPALT 249 Query: 243 RQIEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGLKCYPSQT 302 + R+PFN + L QAAA+AAL D AF+ E N AG Q GL+ PS Sbjct: 250 DLLNRIRQPFNVNSLAQAAAVAALGDAAFLQRSAELNRAGKAQLVAAFDRLGLQYVPSSG 309 Query: 303 NFVLIDFKR---PADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEILAILAEI 359 NFVL+ R + ALL++G IVR P LRITIG E+N +A L + Sbjct: 310 NFVLVRVGRDDGAGARVNLALLKQGVIVRPVGNYNLPQWLRITIGLPEENAAFIAALEKA 369 Query: 360 L 360 L Sbjct: 370 L 370 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 371 Length adjustment: 30 Effective length of query: 330 Effective length of database: 341 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS04465 RR42_RS04465 (aspartate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.3695.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-111 356.8 0.0 5.9e-111 356.7 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS04465 RR42_RS04465 aspartate aminotran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS04465 RR42_RS04465 aspartate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.7 0.0 5.9e-111 5.9e-111 3 348 .. 12 368 .. 10 369 .. 0.97 Alignments for each domain: == domain 1 score: 356.7 bits; conditional E-value: 5.9e-111 TIGR01141 3 kikklepYqpg......arelgek..evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkea 63 +++++pY++g are+g +vkL+snEnP+g++e+++ a+ +++++l rYpd+++++lk a lcl|FitnessBrowser__Cup4G11:RR42_RS04465 12 YVRAISPYVAGkpisevAREFGLVesTIVKLASNENPLGMPESARTAIAAAVADLGRYPDANGFALKGA 80 5899*************9999998889****************************************** PP TIGR01141 64 lakylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqed 132 l+++++v ++ ++lgnGs++++e+ ++a+++pg++++++e+++++Y++ ++ ga+ +ev++++ g +d lcl|FitnessBrowser__Cup4G11:RR42_RS04465 81 LSARFDVPPDWLTLGNGSNDILEIAAHALVKPGESIVYAEHSFAVYALATQEVGARAIEVKARDYG-HD 148 ****************************************************************95.9* PP TIGR01141 133 leavleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlella 197 l+a+++a++ +++lvf+a+PnnPtG++l ++eie++l++v +d++VV+DeAY+e+ ++ ++ + +++ lcl|FitnessBrowser__Cup4G11:RR42_RS04465 149 LDAMAVAIAPDTRLVFIANPNNPTGTFLPAAEIETFLAKVpADVVVVLDEAYNEYLDDaqqYDSIAWVR 217 ****************************************88*************9998889999**** PP TIGR01141 198 eypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveev 266 +ypnl+v+rT+SKa+gLAglR+Gya+a++++ + l+++r+p+nv+sla++aavaal d+++++++ e + lcl|FitnessBrowser__Cup4G11:RR42_RS04465 218 KYPNLLVSRTFSKAYGLAGLRIGYAVAQPALTDLLNRIRQPFNVNSLAQAAAVAALGDAAFLQRSAELN 286 ********************************************************************* PP TIGR01141 267 kkererlleelkkleglevyeSkaNFvlikvke...daeelleallekgiivRdlksaeglleeclRit 332 ++++++l +++ l gl++++S +NFvl++v + + +++ all++g+ivR ++++ + l+++lRit lcl|FitnessBrowser__Cup4G11:RR42_RS04465 287 RAGKAQLVAAFDRL-GLQYVPSSGNFVLVRVGRddgAGARVNLALLKQGVIVRPVGNY-N-LPQWLRIT 352 **************.8***************998888899999***************.5.6******* PP TIGR01141 333 vGtreenerllealke 348 +G +een ++++al++ lcl|FitnessBrowser__Cup4G11:RR42_RS04465 353 IGLPEENAAFIAALEK 368 *************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.01 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory