Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate RR42_RS16090 RR42_RS16090 threonine-phosphate decarboxylase
Query= curated2:Q67KI2 (361 letters) >FitnessBrowser__Cup4G11:RR42_RS16090 Length = 350 Score = 86.3 bits (212), Expect = 1e-21 Identities = 91/303 (30%), Positives = 129/303 (42%), Gaps = 30/303 (9%) Query: 80 LPAD-WFLIGNGSDEVFRLLAEVYLEPGDRVVVPEPSFAAYRFVAELMGAEVVAVPLAGW 138 LPAD W + D + L A+ Y P R + S AA R + +L+ V V + G+ Sbjct: 42 LPADAWLRLPQDDDGLAELAAQAYGAP--RALPVAGSQAAIRTLPQLLRPGRVGVAVQGY 99 Query: 139 TMDLPAMAEAAARGAKL----------------LFLCRPNNPTGTVFAEADLRA-ALERV 181 + PA A A L L + PNNPTG A+A LRA + Sbjct: 100 SEYAPAFARAGHEVVPLAETDFAREDLAAQLDHLVVVNPNNPTGRTLAQATLRAWHADLA 159 Query: 182 PPSTLVVVDEAYREFDETPFDSRALVQDYPNVVIARTFSKIYGMAGFRLGYGVMRPEVLA 241 +++DEA+ D TP S A + D P +V+ R+ K YG+AG R G+ + P +LA Sbjct: 160 ARGGTLLLDEAF--MDCTPERSLAALADRPGMVVLRSLGKFYGLAGVRCGFVLAEPILLA 217 Query: 242 PLYTARDPFSVNGLAVAAGLAALDDVEHVERTRALTREGKAYLYAAFQRLGLGYVPSEAN 301 L ++V G A A AL D TR ++ L ++ GL P Sbjct: 218 ALADQLGHWTVAGPARAVARLALADRTWQAATRDRLQQAGIRLATLLRKHGL--TPVGRP 275 Query: 302 FVLFDAGRPAAEVFDALLRRGVLVR----PCGSFGLPDHLRVTVGTPEQNRRFVEALKAA 357 + AA + +AL R+GV R P G G LR +G P + L AA Sbjct: 276 LFSWVPHADAARLHEALARQGVWTRLFDAPPGIPGALPSLR--LGLPPAQEPAWQRLDAA 333 Query: 358 LGE 360 L + Sbjct: 334 LAQ 336 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 350 Length adjustment: 29 Effective length of query: 332 Effective length of database: 321 Effective search space: 106572 Effective search space used: 106572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory