Align Histidinol-phosphate aminotransferase; EC 2.6.1.9 (characterized, see rationale)
to candidate RR42_RS18910 RR42_RS18910 histidinol-phosphate aminotransferase
Query= uniprot:A0A2R7PAQ8 (373 letters) >FitnessBrowser__Cup4G11:RR42_RS18910 Length = 366 Score = 376 bits (965), Expect = e-109 Identities = 200/361 (55%), Positives = 259/361 (71%), Gaps = 11/361 (3%) Query: 15 IRPDVRAMHSYVVQPSTGMLKMDAMENPFRLPAHLQAALGQRLGSVALNRYPGDRIADLK 74 IR DVRAM +Y V S G++K+DAMENP++LP L+A L RL VALNRYP L+ Sbjct: 13 IRDDVRAMGAYHVPDSHGLVKLDAMENPYQLPDALRAKLAARLAEVALNRYPVPSSEVLR 72 Query: 75 AALAQYAGMPEGYGIVLGNGSDELITLLALACAQPGTGQRATMLAPMPGFVMYPLSAQLQ 134 A L +P G ++LGNGSDE+I++L+LA A+PG A +LAP+PGFVMY +SAQ Sbjct: 73 ARLKTVMDVPAGMDVLLGNGSDEIISMLSLAAAKPG----AKVLAPVPGFVMYAMSAQFA 128 Query: 135 GLDFVGVPLTPDFELDEPAMLAAIGQHRPAITYIAYPNNPTATLWDEGAVQRIIDAAGAQ 194 GL+FVGVPL DF LD AMLAA+ +H+PAI Y+AYPNNPT L+D ++ I+ AA + Sbjct: 129 GLEFVGVPLKADFTLDRAAMLAAMAEHQPAIIYLAYPNNPTGNLFDADDMEAIVRAAQGE 188 Query: 195 G--GIVVMDEAYQPFASRTWIDRMRAEPARNAHVLLMRTLSKFGLAGVRLGYLIGPSAFV 252 +VV+DEAYQPFA TW+ R+ A ++L+MRT+SK GLAG+RLGYL G A++ Sbjct: 189 TCQSLVVVDEAYQPFAQDTWMPRL----AEFGNLLVMRTVSKLGLAGIRLGYLAGAPAWL 244 Query: 253 SEIDKVRPPYNVSVLNCEAALFALEHAEVFAAQAAEIRVERATLIAALRQMPGVEKCWDS 312 S+IDKVRPPYNV+VL ALF LEH +V QAA++R ERAT+ +AL +PGV + S Sbjct: 245 SQIDKVRPPYNVNVLTEATALFVLEHVDVLDQQAAQLRAERATVASALAALPGV-TVYPS 303 Query: 313 EANMVLIRVADSAKAYEGMKNRKVLVKNVSTMHPLLANCLRLTVGNAEDNAQMLAALQAS 372 AN +L+RV DSA+ ++G+ RKVL+KNV MHPLLANCLR+TV E+NAQ L A QA+ Sbjct: 304 AANFLLVRVDDSARVFDGVLARKVLIKNVGKMHPLLANCLRVTVSTPEENAQFLVAFQAA 363 Query: 373 L 373 L Sbjct: 364 L 364 Lambda K H 0.321 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 366 Length adjustment: 30 Effective length of query: 343 Effective length of database: 336 Effective search space: 115248 Effective search space used: 115248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS18910 RR42_RS18910 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.23066.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-97 311.0 0.0 4.9e-97 310.9 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS18910 RR42_RS18910 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS18910 RR42_RS18910 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.9 0.0 4.9e-97 4.9e-97 1 347 [. 14 361 .. 14 363 .. 0.95 Alignments for each domain: == domain 1 score: 310.9 bits; conditional E-value: 4.9e-97 TIGR01141 1 rekikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealak 66 r++++++ +Y+ + ++ + vkL+++EnP++ +++++++l ++l+ l+rYp p++ l+++l lcl|FitnessBrowser__Cup4G11:RR42_RS18910 14 RDDVRAMGAYHVP-----DShGLVKLDAMENPYQLPDALRAKLAARLAevALNRYPVPSSEVLRARLKT 77 6788999999984.....33378************************98999***************** PP TIGR01141 67 ylgvee.enillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedle 134 +++v + ++llgnGsde+i++l a ++pg++vl++ p + mY++sa++ag e + vplk+d++ d + lcl|FitnessBrowser__Cup4G11:RR42_RS18910 78 VMDVPAgMDVLLGNGSDEIISMLSLAAAKPGAKVLAPVPGFVMYAMSAQFAGLEFVGVPLKADFTLDRA 146 ***765279******************************************************999999 PP TIGR01141 135 avle.aakekvklvflasPnnPtGnllkreeiekvleev..e..dalVVvDeAYieFseeasvlellae 198 a+l+ a++++ +++la+PnnPtGnl++++++e+++ ++ e + lVVvDeAY F+++ ++++ lae lcl|FitnessBrowser__Cup4G11:RR42_RS18910 147 AMLAaMAEHQPAIIYLAYPNNPTGNLFDADDMEAIVRAAqgEtcQSLVVVDEAYQPFAQD-TWMPRLAE 214 988868999**************************99886435678*************8.******** PP TIGR01141 199 ypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevk 267 + nl+v+rT+SK+ LAg+R+Gy+ + +++ ++++kvr+pynv++l+ ++a+ l++ d + ++ ++++ lcl|FitnessBrowser__Cup4G11:RR42_RS18910 215 FGNLLVMRTVSKLG-LAGIRLGYLAGAPAWLSQIDKVRPPYNVNVLTEATALFVLEHVDVLDQQAAQLR 282 ************86.****************************************************** PP TIGR01141 268 kererlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtr 336 +er+ + ++l++l+g+ vy+S aNF+l++v+ d++++++ +l +++++++++++++ll +clR+tv t+ lcl|FitnessBrowser__Cup4G11:RR42_RS18910 283 AERATVASALAALPGVTVYPSAANFLLVRVD-DSARVFDGVLARKVLIKNVGKMHPLLANCLRVTVSTP 350 ******************************9.************************************* PP TIGR01141 337 eenerllealk 347 een ++l a++ lcl|FitnessBrowser__Cup4G11:RR42_RS18910 351 EENAQFLVAFQ 361 *******9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory