GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisE in Cupriavidus basilensis 4G11

Align Phosphoribosyl-AMP cyclohydrolase; PRA-CH; EC 3.5.4.19 (characterized)
to candidate RR42_RS18880 RR42_RS18880 phosphoribosyl-AMP cyclohydrolase

Query= SwissProt::O26347
         (138 letters)



>FitnessBrowser__Cup4G11:RR42_RS18880
          Length = 135

 Score =  111 bits (278), Expect = 4e-30
 Identities = 58/118 (49%), Positives = 78/118 (66%), Gaps = 7/118 (5%)

Query: 23  LIIAVAQDHETGEVLMVAYMNREALRRTLETGTAHYWSTSRGKLWLKGESSGHVQRVKDV 82
           L+  + Q+  + +VLM A+MNREAL+RT E G A +WS SR +LW KGE SGHVQ+V ++
Sbjct: 16  LVPVIVQEVGSNDVLMFAFMNREALQRTAEIGEAVFWSRSRKRLWHKGEESGHVQKVHEM 75

Query: 83  LVDCDGDAVVLKVEQEGG-ACHTGYRSCFYRSIDGD----ELKVREDAVKVFDPEEIY 135
            +DCD D V+LKV Q  G ACHTG  SCF++  +GD    + +  E  +K  DP  IY
Sbjct: 76  RLDCDEDVVLLKVTQNDGIACHTGRHSCFFQKFEGDAESGDWQTVEPVLK--DPSTIY 131


Lambda     K      H
   0.318    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 84
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 138
Length of database: 135
Length adjustment: 15
Effective length of query: 123
Effective length of database: 120
Effective search space:    14760
Effective search space used:    14760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

Align candidate RR42_RS18880 RR42_RS18880 (phosphoribosyl-AMP cyclohydrolase)
to HMM PF01502 (PRA-CH)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF01502.22.hmm
# target sequence database:        /tmp/gapView.4872.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PRA-CH  [M=74]
Accession:   PF01502.22
Description: Phosphoribosyl-AMP cyclohydrolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
      3e-40  122.3   0.3    7.7e-40  121.0   0.4    1.6  2  lcl|FitnessBrowser__Cup4G11:RR42_RS18880  RR42_RS18880 phosphoribosyl-AMP 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS18880  RR42_RS18880 phosphoribosyl-AMP cyclohydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.0   0.4   7.7e-40   7.7e-40       1      74 []      31     105 ..      31     105 .. 0.98
   2 ?   -2.3   0.0      0.23      0.23      35      46 ..     113     124 ..     109     127 .. 0.78

  Alignments for each domain:
  == domain 1  score: 121.0 bits;  conditional E-value: 7.7e-40
                                    PRA-CH   1 mlaymneealektletgkavyySrsrqklwkkGetsgnvqkvkeirldcDeDalllkveqk.gaaCHtg 68 
                                               m+a+mn+eal++t e g+av++Srsr++lw+kGe+sg+vqkv+e+rldcDeD++llkv+q+ g aCHtg
  lcl|FitnessBrowser__Cup4G11:RR42_RS18880  31 MFAFMNREALQRTAEIGEAVFWSRSRKRLWHKGEESGHVQKVHEMRLDCDEDVVLLKVTQNdGIACHTG 99 
                                               99**********************************************************9679***** PP

                                    PRA-CH  69 ersCFy 74 
                                               ++sCF+
  lcl|FitnessBrowser__Cup4G11:RR42_RS18880 100 RHSCFF 105
                                               *****6 PP

  == domain 2  score: -2.3 bits;  conditional E-value: 0.23
                                    PRA-CH  35 tsgnvqkvkeir 46 
                                               +sg+ q+v+ + 
  lcl|FitnessBrowser__Cup4G11:RR42_RS18880 113 ESGDWQTVEPVL 124
                                               799999998765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                          1  (135 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 3.74
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory