Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate RR42_RS18920 RR42_RS18920 ATP phosphoribosyltransferase catalytic subunit
Query= reanno::HerbieS:HSERO_RS20350 (216 letters) >FitnessBrowser__Cup4G11:RR42_RS18920 Length = 220 Score = 356 bits (914), Expect = e-103 Identities = 184/212 (86%), Positives = 195/212 (91%) Query: 4 QLTLALSKGRIFEETLPLLKAAGITVSEDPESSRKLILPTNDPDVRVIIVRASDVPTYVQ 63 QLTLALSKGRIF ET+PLL+AAGI V+EDPE+SRKLILPT+DPDVRVIIVRASDVPTYVQ Sbjct: 7 QLTLALSKGRIFSETMPLLEAAGIHVTEDPETSRKLILPTSDPDVRVIIVRASDVPTYVQ 66 Query: 64 YGAADFGVAGKDVLLEHGGEGLYQPIDLNIAKCRLSVAVQEGFDYANAVRQGARLRVVTK 123 YGAADFGVAGKDVL+EHG GLY PIDLNIAKCR+SVA GFDYA+AVRQGARL V TK Sbjct: 67 YGAADFGVAGKDVLMEHGMAGLYAPIDLNIAKCRMSVATSAGFDYASAVRQGARLAVATK 126 Query: 124 YVNTAREHFAAKGVHVDLIKLYGSMELGPLVGLSDAIVDLVSTGGTLRANKLVEVEHIID 183 YV TAREHFA KGVHVDLIKLYGSMELGPLVGL+DAIVDLVSTGGTLRAN LVEVE I+ Sbjct: 127 YVQTAREHFAKKGVHVDLIKLYGSMELGPLVGLADAIVDLVSTGGTLRANNLVEVEEIVQ 186 Query: 184 ISSRLVVNQAALKLKRERLQPILDAFEKASKA 215 ISSRLVVNQAALKLKRERL PILDAFE+AS A Sbjct: 187 ISSRLVVNQAALKLKRERLAPILDAFERASAA 218 Lambda K H 0.318 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 220 Length adjustment: 22 Effective length of query: 194 Effective length of database: 198 Effective search space: 38412 Effective search space used: 38412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate RR42_RS18920 RR42_RS18920 (ATP phosphoribosyltransferase catalytic subunit)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.11796.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-62 195.7 0.1 3.7e-62 195.5 0.1 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS18920 RR42_RS18920 ATP phosphoribosylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS18920 RR42_RS18920 ATP phosphoribosyltransferase catalytic subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 195.5 0.1 3.7e-62 3.7e-62 1 183 [] 8 193 .. 8 193 .. 0.95 Alignments for each domain: == domain 1 score: 195.5 bits; conditional E-value: 3.7e-62 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitG 67 l++Al KGr++ et+ lle+ag+++++ +rkli ++d++v+v+++ra+d+ptyv++gaad+G+ G lcl|FitnessBrowser__Cup4G11:RR42_RS18920 8 LTLALSKGRIFSETMPLLEAAGIHVTEDPetSRKLILPTSDPDVRVIIVRASDVPTYVQYGAADFGVAG 76 79**********************99877789************************************* PP TIGR00070 68 kDlleEsead.vvelldlgfgkcklvlAvpeesdvesledlkegk..riATkypnltreylekkgvkve 133 kD+l+E++ + ++ +dl++ kc++++A+ d+ s ++++g+ +ATky++++re+++kkgv+v+ lcl|FitnessBrowser__Cup4G11:RR42_RS18920 77 KDVLMEHGMAgLYAPIDLNIAKCRMSVATSAGFDYAS--AVRQGArlAVATKYVQTAREHFAKKGVHVD 143 ******88888**********************9998..555544358********************* PP TIGR00070 134 ivkleGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 ++kl+G++El pl+gladaIvD+v+tG tLr+n+L+++eei+++s+rl++ lcl|FitnessBrowser__Cup4G11:RR42_RS18920 144 LIKLYGSMELGPLVGLADAIVDLVSTGGTLRANNLVEVEEIVQISSRLVV 193 ***********************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (220 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.83 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory