Align Histidinol-phosphatase (EC:3.1.3.15) (characterized)
to candidate RR42_RS28245 RR42_RS28245 phosphoserine phosphatase
Query= reanno::BFirm:BPHYT_RS03625 (228 letters) >FitnessBrowser__Cup4G11:RR42_RS28245 Length = 232 Score = 222 bits (566), Expect = 4e-63 Identities = 112/225 (49%), Positives = 145/225 (64%), Gaps = 3/225 (1%) Query: 1 MANLALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFFADYKAGKLDIHAYLI 60 M+ LALFDLDHTL+P DS++EW R++V+ G DA N + A+Y AG+LDIH + Sbjct: 1 MSCLALFDLDHTLLPLDSEYEWARYLVEAGAADAAEVEANNALWLAEYSAGRLDIHRHAA 60 Query: 61 AMLTPLSKYTRAQLADFHAQYMHEVIKPAIFPVALELVKQHRETGDLCCVVTATNEFITR 120 L L+++ AQL + +M +VI PAI P A L+ H++ GDLCC+VTAT F+T Sbjct: 61 FALGLLARHPHAQLEGLRSGFMRDVIAPAIRPEARALLATHQDAGDLCCIVTATCRFVTE 120 Query: 121 PIAQAFGVDALIACEAETVDGEPHSPYTGRPTGTPSYKEGKIVRTEAWLASLGKTWSDFE 180 PIA+A GV L+A EA + +TG G PS+ GKI R WL SLG W+ FE Sbjct: 121 PIAEALGVAHLLAVEAAR---DASGNFTGAVDGVPSFGVGKIARVAQWLESLGMAWAHFE 177 Query: 181 RSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRILELF 225 R+ FYSDS NDIPLLE V+ P+ATNPD LRA A +GW +L LF Sbjct: 178 RTVFYSDSRNDIPLLEAVSHPVATNPDAALRALANTRGWPLLMLF 222 Lambda K H 0.320 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 232 Length adjustment: 23 Effective length of query: 205 Effective length of database: 209 Effective search space: 42845 Effective search space used: 42845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory