Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (characterized)
to candidate RR42_RS06125 RR42_RS06125 phosphogluconate dehydratase
Query= SwissProt::P55186 (617 letters) >FitnessBrowser__Cup4G11:RR42_RS06125 Length = 628 Score = 197 bits (502), Expect = 9e-55 Identities = 184/594 (30%), Positives = 267/594 (44%), Gaps = 65/594 (10%) Query: 37 IAVANSFTQFVPGHVHLKDLGQLVAREIEAAGGVAKEFNTI-AVDDGIAMGHGGMLYSLP 95 + + ++ + H + ++ A G VA+ + A+ DGI G+ GM SL Sbjct: 72 LGIVTAYNDMLSAHQPYERYPGVIREAARAVGAVAQVAGGVPAMCDGITQGNAGMELSLF 131 Query: 96 SRDLIADSVEYMVNAHCADAIVCISNCDKITPGMLMAAMRL-NIPVVFVSGGPMEAGKVT 154 SRD IA + ++ + DA V + CDKI PG+LM A++ ++PVVFV GPM G ++ Sbjct: 132 SRDAIAMATAVSLSHNTFDAAVMLGVCDKIVPGLLMGALQFGHLPVVFVPAGPMSTG-LS 190 Query: 155 VKGKIRALDLVDAMVVAADDSYSDEEV--EAIEKAACPT---CGSCSGMFTANSMNCLTE 209 K K R L Y+ +V EA+ +A C G+C+ TANS L E Sbjct: 191 NKEKARVRQL-----------YATGQVGREALLEAECEAYHGAGTCTFYGTANSNQFLME 239 Query: 210 ALGLSLPGNGSVLATHADREALFKEAGRVVVDLCQRWYEQEDATALPRGIATRAAFENAM 269 +GL +PG V R+AL A + + L R D L R + RA + Sbjct: 240 IMGLHMPGAAFVHPDSGLRDALTAAAAQRALALTAR---GGDYLPLARIVDERAVINAVV 296 Query: 270 SLDIAMGGSTNTVLHLLAAAHEGGIDFSMADIDRLSRHVPCLSKVAPAKSDVHMEDVHRA 329 L +A GGSTN +HL+A A GI D DRLSR P L++V P + H A Sbjct: 297 GL-LATGGSTNHTIHLVAMARAAGILIDWDDFDRLSRITPLLARVYP-NGSADVNHFHAA 354 Query: 330 GGVMAILGELERGGLIDASQPTVHAPTMGEALARWDIGRTNSQIAHEFFKAAPGGKPTQV 389 GGV ++ +L GL+ TV G LAR+ V Sbjct: 355 GGVAYVIRQLLSAGLLHEDVETV----AGRGLARY--------------------TQEPV 390 Query: 390 AFSQAARWEE-LDLDRENGVIRSVEHPFSKDGGLAVLFGNLAPEGCIVKTAGVDESILTF 448 +W + + + V+ + PFS +GGL +L GNL ++K + V + Sbjct: 391 MIDGVLQWRDGAAVSGDATVLATAAEPFSAEGGLRLLQGNLGRG--MIKVSAVADEHRVV 448 Query: 449 RGTARVFESQDAAVSGILGGQVKAGEVVVIRYEGPKGGPGMQEMLYPTTYLKS-KGLGAA 507 ARVF+SQ+ + G+ + V+R++GP GM E+ T L S + G Sbjct: 449 EAPARVFDSQEQLQAAFEAGEFTGDMIAVVRFQGPNAN-GMPELHRLTPVLGSLQDAGHK 507 Query: 508 CALVTDGRFSGGTSGL-SIGHVSPEAGEGGLIALVETGDPILIDIPTRGITLE-----VS 561 ALVTDGR SG + + ++ HV PEA GG +A V GD I +D TLE Sbjct: 508 VALVTDGRMSGASGKVPAVIHVGPEALAGGPLARVRDGDRIRVDAVAG--TLEWLGAANG 565 Query: 562 DAVLAARREAQLARGKDAWTPLNRKRDLTPALRAYAAMTTNAARGAVRDVSQIE 615 D LA R A L DA+ + R L R A + G+ D+S+ + Sbjct: 566 DGDLATRASAVLP--DDAFANFSVGRGLFGLFRRNARIAEEG--GSALDLSEAD 615 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1075 Number of extensions: 60 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 617 Length of database: 628 Length adjustment: 37 Effective length of query: 580 Effective length of database: 591 Effective search space: 342780 Effective search space used: 342780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory