GapMind for Amino acid biosynthesis

 

Alignments for a candidate for prpE in Cupriavidus basilensis 4G11

Align propionyl-CoA synthetase (EC 6.2.1.17) (characterized)
to candidate RR42_RS13560 RR42_RS13560 propionyl-CoA synthetase

Query= ecocyc::G6200-MONOMER
         (628 letters)



>FitnessBrowser__Cup4G11:RR42_RS13560
          Length = 630

 Score =  830 bits (2145), Expect = 0.0
 Identities = 402/622 (64%), Positives = 493/622 (79%), Gaps = 1/622 (0%)

Query: 7   YQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARWFCEGRTNLCHNAIDRWLEKQP 66
           + RS+++PE FWAEQARRIDW+TPF   LD S PPF RWF  GRTNLCHNA+DR L ++ 
Sbjct: 8   HARSLSDPEGFWAEQARRIDWETPFDTVLDDSRPPFTRWFVGGRTNLCHNAVDRHLAERA 67

Query: 67  EALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLGVQRGDRVLVYMPMIAEAHITLL 126
           +  ALI VS+ET + RT+++ +LHDEVN +A++L+ LGV +GDRVL+YMPMI EA   +L
Sbjct: 68  DQAALIYVSTETGQHRTYSYAELHDEVNRMAAILQQLGVVKGDRVLIYMPMIPEAAFAML 127

Query: 127 ACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSADAGARGGKIIPYKKLLDDAISQAQ 186
           ACARIGAIHSVVFGGFAS S+AARIDDA+P +IVSADAG+R GK++PYK LLD+A+  A 
Sbjct: 128 ACARIGAIHSVVFGGFASVSLAARIDDAQPRVIVSADAGSRAGKVVPYKPLLDEAVKLAT 187

Query: 187 HQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGARVPVAWLESNETSCILYTSGTTGK 246
           H+P  VLLVDR L+ M    GRD D+ + R +   ARVP AWLES+E S +LYTSGTTGK
Sbjct: 188 HKPERVLLVDRQLSPMTLTPGRDEDYGAWRERVGAARVPCAWLESSEPSYVLYTSGTTGK 247

Query: 247 PKGVQRDVGGYAVALATSMDTIFGGKAGSVFFCASDIGWVVGHSYIVYAPLLAGMATIVY 306
           PKGVQRD GGYAVALA SM+ IF GKAG   F +SDIGWVVGHSYI+Y PLLAGMATI+Y
Sbjct: 248 PKGVQRDTGGYAVALAASMEYIFCGKAGDTMFSSSDIGWVVGHSYIIYGPLLAGMATIMY 307

Query: 307 EGLPTWPDCGVWWTIVEKYQVSRMFSAPTAIRVLKKFPTAEIRKHDLSSLEVLYLAGEPL 366
           EG P  PD G+ W +VE+Y V+ MFSAPTAIRVLKK   A + ++DLSSL +L+LAGEPL
Sbjct: 308 EGTPIRPDGGILWQLVEQYHVNIMFSAPTAIRVLKKQDPAWLTRYDLSSLRLLFLAGEPL 367

Query: 367 DEPTASWVSNTLDVPVIDNYWQTESGWPIMAIARGLDDRPTRLGSPGVPMYGYNVQLLNE 426
           DEPTASW+   +  PV+DNYWQTE+GWPI+AI RGLD  P +LGSPGVP+YGY++++++E
Sbjct: 368 DEPTASWIQQGIGKPVVDNYWQTETGWPIIAIQRGLDPLPAKLGSPGVPVYGYDLKIIDE 427

Query: 427 VTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDDGRFVKTYWS-LFSRPVYATFDWGIRDAD 485
            TG  C   +KG++ ++GPLPPGC+ T+WGDD RFVKTYWS +  R  Y+TFDWG++D D
Sbjct: 428 ATGAECPPGQKGVVAIDGPLPPGCMTTVWGDDERFVKTYWSGVPGRRCYSTFDWGVQDED 487

Query: 486 GYHFILGRTDDVINVAGHRLGTREIEESISSHPGVAEVAVVGVKDALKGQVAVAFVIPKE 545
           GY FILGRTDDVINVAGHRLGTREIEESISSHP VAEVAVVGV DALKGQ A+AFVI ++
Sbjct: 488 GYIFILGRTDDVINVAGHRLGTREIEESISSHPAVAEVAVVGVHDALKGQAAMAFVIVRD 547

Query: 546 SDSLEDRDVAHSQEKAIMALVDSQIGNFGRPAHVWFVSQLPKTRSGKMLRRTIQAICEGR 605
           +     +      E  +M  VD Q+G   RPA V+FV+ LPKTRSGK+LRR +QA+ EGR
Sbjct: 548 AGRTATQADRLVLEGDVMKTVDQQLGAVARPARVFFVNALPKTRSGKLLRRAMQAVAEGR 607

Query: 606 DPGDLTTIDDPASLDQIRQAME 627
           DPGDLTTI+DP +L Q++ AM+
Sbjct: 608 DPGDLTTIEDPTALAQLQAAMQ 629


Lambda     K      H
   0.320    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1244
Number of extensions: 46
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 628
Length of database: 630
Length adjustment: 38
Effective length of query: 590
Effective length of database: 592
Effective search space:   349280
Effective search space used:   349280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

Align candidate RR42_RS13560 RR42_RS13560 (propionyl-CoA synthetase)
to HMM TIGR02316 (prpE: propionate--CoA ligase (EC 6.2.1.17))

Software error:

../bin/blast/fastacmd -i /tmp/list.1298.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.1298.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.