GapMind for Amino acid biosynthesis

 

Aligments for a candidate for asp-kinase in Cupriavidus basilensis 4G11

Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate RR42_RS06370 RR42_RS06370 aspartate kinase

Query= SwissProt::C3JXY0
         (413 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS06370 RR42_RS06370 aspartate
           kinase
          Length = 416

 Score =  519 bits (1336), Expect = e-152
 Identities = 276/416 (66%), Positives = 328/416 (78%), Gaps = 12/416 (2%)

Query: 1   MALIVQKFGGTSVGSVERIEQVADKVKKFRDAGDDLVVVLSAMSGETNRLIDLAKAISGD 60
           MALIV K+GGTS+GS ERI+ VA +V K+  AG  +VVV SAMSGETNRL+ LAK IS  
Sbjct: 1   MALIVHKYGGTSMGSPERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISA- 59

Query: 61  QQPLPRELDVIVSTGEQVTIALLAMALNKRGVPAVSYTGSQVRILTDSAHTKARILQIDD 120
            QP PRELD++ +TGEQ + ALLA+AL   GV A+SYTG QV + TDS+HTKARI  IDD
Sbjct: 60  -QPSPRELDMLAATGEQASSALLAIALQSEGVDAISYTGWQVPVKTDSSHTKARIESIDD 118

Query: 121 QKIRTDLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV 180
           ++I  DL AGRVVVV GFQG+D+ GNITTLGRGGSDT+ VA+AAA++A+EC IYTDVDGV
Sbjct: 119 ERILADLDAGRVVVVTGFQGIDDNGNITTLGRGGSDTSAVAIAAAIEAEECLIYTDVDGV 178

Query: 181 YTTDPRVVSVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKE---- 236
           YTTDPRVV  A+RLD+ITFEEMLEMASLGSKVLQIR+VEFAGKY V  RVL S  +    
Sbjct: 179 YTTDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMP 238

Query: 237 -----GPGTLITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISGANI 291
                  GTLIT +E   ME  +ISGIAF RDEAK+T+ GVPD PG+A++ILGP++ ANI
Sbjct: 239 LEQEMHSGTLITFEENSEMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPVADANI 298

Query: 292 EVDMIVQNVSHDNTTDFTFTVHRNEYDAAERILQNTAK-EIGAREVVGDTKIAKVSIVGV 350
           +VDMI+QN S D  TDFTFTV R EY  A  IL ++ K  IGA  V GD K++KVS+VGV
Sbjct: 299 DVDMIIQNQSVDGKTDFTFTVPRGEYQRALAILNDSVKAHIGAASVSGDPKVSKVSVVGV 358

Query: 351 GMRSHAGVASRMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELD 406
           GMRSH G+AS+MF  L++E INIQMISTSEIK+SV+I+EKY+ELAVRALH  FELD
Sbjct: 359 GMRSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELD 414


Lambda     K      H
   0.316    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 517
Number of extensions: 19
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 413
Length of database: 416
Length adjustment: 31
Effective length of query: 382
Effective length of database: 385
Effective search space:   147070
Effective search space used:   147070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate RR42_RS06370 RR42_RS06370 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00656.hmm
# target sequence database:        /tmp/gapView.8876.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00656  [M=407]
Accession:   TIGR00656
Description: asp_kin_monofn: aspartate kinase, monofunctional class
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   2.5e-130  421.1   7.5   2.8e-130  420.9   7.5    1.0  1  lcl|FitnessBrowser__Cup4G11:RR42_RS06370  RR42_RS06370 aspartate kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS06370  RR42_RS06370 aspartate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  420.9   7.5  2.8e-130  2.8e-130       1     406 [.       1     413 [.       1     414 [. 0.95

  Alignments for each domain:
  == domain 1  score: 420.9 bits;  conditional E-value: 2.8e-130
                                 TIGR00656   1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisp 69 
                                               + liV K+GGts+gs erik++ak+v k  + g++vvVV SAms++t++l+ la      + is ++sp
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370   1 MALIVHKYGGTSMGSPERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLA------KEISAQPSP 63 
                                               579***************************************************......9******** PP

                                 TIGR00656  70 rerdelvsvGEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegiiv 138
                                               re d+l ++GE+ ssall+ al+ +gv+a++++g++ ++ Td+++++A+i++++  er+l  L+ g +v
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370  64 RELDMLAATGEQASSALLAIALQSEGVDAISYTGWQVPVKTDSSHTKARIESIDD-ERILADLDAGRVV 131
                                               ******************************************************9.************* PP

                                 TIGR00656 139 vvaGFiGateeGeiTtLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEa 207
                                               vv+GF+G + +G+iTtLGRGGSD++A+++aaa++A+++ iyTDV+GvyttDPrvve+a+++d+i++eE+
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370 132 VVTGFQGIDDNGNITTLGRGGSDTSAVAIAAAIEAEECLIYTDVDGVYTTDPRVVEDARRLDQITFEEM 200
                                               ********************************************************************* PP

                                 TIGR00656 208 lelAtlGakvlhpralelaveakvpilvrss.........kekeegTlitn..kkens.slvkaialek 264
                                               le+A+lG kvl+ r++e+a ++ v+ +v ss         +e ++gTlit   ++e++  ++++ia+ +
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370 201 LEMASLGSKVLQIRSVEFAGKYRVKTRVLSSltdplmpleQEMHSGTLITFeeNSEMEaAVISGIAFAR 269
                                               ****************************99844444433234459****97563344356********* PP

                                 TIGR00656 265 nvarltvegegmlgkrgilaeifkaLaeeeinvdlisqtese...tsislvvdeedvdeakkaLkeesg 330
                                               + a++tv   g+ +k+gi+ +i + +a+++i+vd+i+q +s    t+ +++v + + ++a ++L++ ++
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370 270 DEAKITVL--GVPDKPGIAYQILGPVADANIDVDMIIQNQSVdgkTDFTFTVPRGEYQRALAILNDSVK 336
                                               ********..9****************************987777********************9986 PP

                                 TIGR00656 331 a.aelesleveedlavvsivgaglveapGvaseifkaleekninilmisssetkisvlvdekdaekavr 398
                                               a ++  s++ + ++ +vs+vg+g++++ G+as++f  l+e++ini mis+se+kisvl+dek++e avr
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370 337 AhIGAASVSGDPKVSKVSVVGVGMRSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVR 405
                                               61469**************************************************************** PP

                                 TIGR00656 399 klheklee 406
                                               +lh+++e+
  lcl|FitnessBrowser__Cup4G11:RR42_RS06370 406 ALHKVFEL 413
                                               ******97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (407 nodes)
Target sequences:                          1  (416 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 8.79
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory