Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate RR42_RS18215 RR42_RS18215 amidohydrolase
Query= curated2:B1MZM9 (387 letters) >FitnessBrowser__Cup4G11:RR42_RS18215 Length = 397 Score = 214 bits (545), Expect = 3e-60 Identities = 123/344 (35%), Positives = 192/344 (55%), Gaps = 13/344 (3%) Query: 9 LQTFRRELHQIPETALEEFKTHDYLLTKLKSWQQDYMTIKTVEALPTAILV-YFQGTNPV 67 +++ RR++H PE +E +T D + L +W I+ L T LV + + Sbjct: 14 IRSIRRDIHAHPELCFKEERTSDVVAQNLAAWG-----IEVHRGLGTTGLVGVIRNGSSK 68 Query: 68 RTIGYRTDIDALPIQEATGLDFASQHPGKMHACGHDVHMTMALGLAQYFSQHQPKDNLI- 126 R+IG R D+DALP+QEA SQH G+MHACGHD H M LG A+Y ++H+ D I Sbjct: 69 RSIGLRADMDALPLQEANTFGHRSQHDGRMHACGHDGHTAMLLGAARYLAEHRNFDGTIN 128 Query: 127 IFFQPAEEAESGGKVAYDMGLFEGKWRPDEFYGIHDQPNLPAGTLSTLAGTLFAGTAELK 186 + FQPAEE G + GLFE ++ D +G+H+ P +PAG+ T AG L A + E + Sbjct: 129 LIFQPAEEGGGGAREMIKDGLFE-RFPCDAVFGMHNWPGMPAGSFGTTAGPLMASSNEFR 187 Query: 187 VDVIGTGGHAAYPHLAKDPIVIAAELIIQLQTVVSRSVDPIAGGVVSVGVINGGFANNVI 246 + V G G HAA PH DP+ A+++ LQ +++R+ PI V+SV +GG A N++ Sbjct: 188 IVVRGKGAHAALPHNGNDPVFTGAQIVSALQGIITRNKRPIDAAVISVTQFHGGDATNIV 247 Query: 247 PDQVHFEGTVRSMTRTGLETMLTRIRKIAEGLAIANEVTINVSLESGSYLPVEN---DPI 303 PDQV GTVR+ T L+ + R+ ++++ +A A + T+ +Y P N + Sbjct: 248 PDQVWIGGTVRTFTLPVLDLIERRMEEVSKAVASAFDCTVEFEFHR-NYPPTVNSATETA 306 Query: 304 LATQVINFMQKQSDINFELAQPAMTGEDFGYLLQHIPGVMLWLG 347 A +V + + +++ + +P M EDF ++L PG L++G Sbjct: 307 FAVEVASELVGAGNVDGNI-EPTMGAEDFSFMLLEKPGCYLFIG 349 Lambda K H 0.319 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 397 Length adjustment: 31 Effective length of query: 356 Effective length of database: 366 Effective search space: 130296 Effective search space used: 130296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory