Align isocitrate-homoisocitrate dehydrogenase (EC 1.1.1.286) (characterized)
to candidate RR42_RS17135 RR42_RS17135 isocitrate dehydrogenase
Query= BRENDA::Q4J6C9 (411 letters) >FitnessBrowser__Cup4G11:RR42_RS17135 Length = 416 Score = 372 bits (956), Expect = e-108 Identities = 190/394 (48%), Positives = 269/394 (68%), Gaps = 8/394 (2%) Query: 23 VPNKPIILYIEGDGIGPEITNSAIRVVNKAVEKAYKSSREIKWLEVYAGEKANKITGDR- 81 VP+ PII +IEGDG G +IT I+VV+ AV KAY R+I W+E+YAGEK+ K+ G Sbjct: 23 VPDNPIIPFIEGDGTGLDITPVMIKVVDAAVAKAYGGKRKISWMEIYAGEKSTKVYGPDV 82 Query: 82 -FPKETQDMLLKYRVVLKGPLETPIGKGWKSINVAIRLMLDLYANIRPVKYIEGLESPLK 140 P+ET ++L Y V +KGPL TP+G G +S+NVA+R LDLY +RPV Y +G+ SP++ Sbjct: 83 WLPEETLEVLKDYVVSIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVAYFKGVPSPVR 142 Query: 141 HPEKVDMIIFRENTDDLYRGIEFPYDSEEAKKIRKFLREEL---KVDIEDDTGIGLKVMS 197 P+K+DM+IFREN++D+Y GIE+ +S++AKK+ FL+ E+ K+ D +GIG+K +S Sbjct: 143 EPQKIDMVIFRENSEDIYAGIEWEAESDQAKKLIAFLQNEMGVKKIRFPDTSGIGVKPVS 202 Query: 198 KFKTQRITRLALNYALQNSRKKVTVMHKGNVMKYTEGSFREWAYEVALNEYRDKIVTEEE 257 K T+R+ R A+ YA+ N + VT++HKGN+MK+TEG FR+WAYE+A E+ +++ Sbjct: 203 KQGTKRLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEGGFRDWAYELAQQEFGAELIDGGP 262 Query: 258 INRGVNSEG--KVILNDRIADNMLQQIIIRPDEYDIILAPNVNGDYISDAAGALIGNIGM 315 + N + ++++ D IAD LQQI++RP EY +I N+NGDYISDA A +G IG+ Sbjct: 263 WCKFKNPKTGREIVIKDAIADAFLQQILLRPAEYSVIATLNLNGDYISDALAAQVGGIGI 322 Query: 316 LGGANIGDTGGMFEAIHGTAPKYAGKNVANPTGIIKSCELMLYFMGWSEAARLIEKAINE 375 GAN+ D+ MFEA HGTAPKYAGK+ NP I S E+ML MGW+EAA LI ++ + Sbjct: 323 APGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHMGWTEAADLIISSMEK 382 Query: 376 SIKQKKVTQDIARYL-GITPLGTKEYTDTLVQIM 408 SI KKVT D AR L G T + + ++ M Sbjct: 383 SILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM 416 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 416 Length adjustment: 31 Effective length of query: 380 Effective length of database: 385 Effective search space: 146300 Effective search space used: 146300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory