Align isocitrate dehydrogenase (NAD+) (EC 1.1.1.41) (characterized)
to candidate RR42_RS29535 RR42_RS29535 isocitrate dehydrogenase
Query= BRENDA::Q945K7 (374 letters) >FitnessBrowser__Cup4G11:RR42_RS29535 Length = 346 Score = 269 bits (688), Expect = 7e-77 Identities = 146/338 (43%), Positives = 208/338 (61%), Gaps = 11/338 (3%) Query: 44 ITATLFPGDGIGPEIAESVKKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRN 103 I TL PGDGIGPE+ E+ KV G P W+ G L +L+S+RR Sbjct: 9 IPTTLIPGDGIGPEVVEATVKVLDALGAPFAWDIQQAGMAGIECGGDPLPDATLDSIRRT 68 Query: 104 KVGLKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSL-PGYKTRYDDVDLITIRENTE 162 + LKGP+ TP+G G RS+N+ LR+ NLYANVRP +L PG R++D+DL+ +REN Sbjct: 69 GLALKGPLTTPVGGGFRSVNVRLREAFNLYANVRPARTLVPG---RFEDIDLVLVRENVG 125 Query: 163 GEYSGLEHQVVRG-----VVESLKIITRQASLRVAEYAFLYAKTHGRERVSAIHKANIMQ 217 G Y ++ + G V S TR A R+A +AF YA +GR++++ +HKANI++ Sbjct: 126 GFYVAHDYYIPVGDDPHAVAVSTGTNTRDACRRIARFAFEYAVRNGRKKITVVHKANILK 185 Query: 218 KTDGLFLKCCREVAEKYPE-ITYEEVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCA 276 G+FL REVA+ Y + + ++ ++D C M LV NP FD+L+ NL+GDI+SD A Sbjct: 186 ALTGIFLDAAREVAKDYADRVIMDDRIVDACAMQLVLNPWQFDMLLCTNLFGDILSDQIA 245 Query: 277 GLVGGLGLTPSCNIGEDGVALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKFNEQA 336 GLVGGLG+ P NIGE A+ EAVHGSAPDIAGK +ANP +L+L+ +ML H+ + A Sbjct: 246 GLVGGLGMAPGANIGEHA-AIFEAVHGSAPDIAGKGIANPISLMLAAGLMLEHVGRQDMA 304 Query: 337 EQIHSAIINTIAEGKYRTADLGGSSTTTEFTKAICDHL 374 ++ AI T+ + +T DL G+++T F A+ + Sbjct: 305 LRLRQAIEQTLNVDQVKTGDLKGTASTLHFADAVAKRI 342 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 346 Length adjustment: 29 Effective length of query: 345 Effective length of database: 317 Effective search space: 109365 Effective search space used: 109365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory