Align Probable methanogen homoaconitase large subunit; HACN; EC 4.2.1.114; Homoaconitate hydratase (uncharacterized)
to candidate RR42_RS33965 RR42_RS33965 3-isopropylmalate dehydratase
Query= curated2:Q8PZT3 (391 letters) >FitnessBrowser__Cup4G11:RR42_RS33965 Length = 653 Score = 192 bits (489), Expect = 2e-53 Identities = 133/335 (39%), Positives = 175/335 (52%), Gaps = 16/335 (4%) Query: 66 SIPNFYEIGEGICHQVLPENGFALPGKLLVGADSHSCTYGAFGAFATGVGATDMAEIFAT 125 ++P EGICH ++ E +ALPG+++VG DSH+ GA G A G GATD+A + T Sbjct: 309 ALPGDVPGSEGICHALMAEQ-YALPGQVVVGTDSHTPHSGALGCLAFGAGATDVANSWVT 367 Query: 126 GKLWFKVPESFRMTVEGSLDKHVYAKDLTLYLIGKTGI--AGATYKAVEFYGQAISELSV 183 G + KVPE+ R+ VEG L V AKD+ LYL+ I GA E+ G + LS+ Sbjct: 368 GYVRCKVPETLRVEVEGELAPGVSAKDIVLYLLQMDAIRSGGAIGVVFEYAGSTVRALSI 427 Query: 184 AGRMTLCNMAIEMGAKTGIVPPDEKTFDFLKNRAVAPY---EPVYSDPDASYLKEFVYDA 240 R TL NM E+G TGIV PD+KT FLK R + + + SD A+Y DA Sbjct: 428 DERATLTNMVAELGGFTGIVEPDDKTVAFLKARRGVDFAIEDWMRSDAGATYRDVIRIDA 487 Query: 241 GDIEPQVACPHQVDN-VKPVGEVEGTHVDQVFIGTCTNGRLEDLEVAASVLK-----GKK 294 I P VA P N + + VD + G+CT G+ ED + VL+ G K Sbjct: 488 AAIAPMVARPGDPGNGIAANTLAQPVPVDIAYGGSCTAGKREDFDYYHEVLRWGLEHGLK 547 Query: 295 VTVRTIIIPASRSTLLAAI--KNGTMEILLKAGVTLATPGCGPCLGAHQGVLGEGE-VCV 351 V+ RT + + + A G M+ AG TL PGCG C G E V + Sbjct: 548 VSPRTRLFLQFGTLGVKAYCEARGYMDTFAAAGATLVMPGCGSCANCGPGASTTSEQVTI 607 Query: 352 STANRNFKGRMGKDGFIYLASPATAAASALTGEIT 386 S NRNF GR G G ++LASP T AASAL G+I+ Sbjct: 608 SAINRNFPGRSG-PGQVWLASPYTVAASALAGQIS 641 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 653 Length adjustment: 34 Effective length of query: 357 Effective length of database: 619 Effective search space: 220983 Effective search space used: 220983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory