Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate RR42_RS21080 RR42_RS21080 3-isopropylmalate dehydratase
Query= SwissProt::Q58667 (170 letters) >FitnessBrowser__Cup4G11:RR42_RS21080 Length = 170 Score = 125 bits (315), Expect = 3e-34 Identities = 69/160 (43%), Positives = 102/160 (63%), Gaps = 3/160 (1%) Query: 5 GRAHKFGDDVDTDAIIPGPYLRTTDPYELASHCMAGIDENFPKKVKEGDVIVAGENFGCG 64 GR +FGD+VDTD + PG +++ E+A HC+AG+ FP V+ GD++VAG NFG G Sbjct: 12 GRIWRFGDNVDTDQMAPGTHMKG-GVEEIARHCLAGLRPEFPAAVRPGDLLVAGRNFGVG 70 Query: 65 SSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGL-IPIIANTDEIKDGDIVEIDLDKE 123 SSREQA A+++ G+ AVIA SFA +FYRNAIN+GL + + + + DG ++L + Sbjct: 71 SSREQAPQALRHLGLAAVIAPSFAGLFYRNAINLGLPVLVCHDATRLVDGAAARLELGQA 130 Query: 124 EIVITNKNKTIKCETPKGLEREILAAGGLVNYLKKRKLIQ 163 +V+ + ++ + CE +L AGGLV +LK R Q Sbjct: 131 CLVLPDGSR-VACEPIPEFLHALLQAGGLVPHLKARLAAQ 169 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 170 Length adjustment: 18 Effective length of query: 152 Effective length of database: 152 Effective search space: 23104 Effective search space used: 23104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory