Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate RR42_RS01160 RR42_RS01160 homoserine O-acetyltransferase
Query= SwissProt::F7XKY8 (492 letters) >FitnessBrowser__Cup4G11:RR42_RS01160 Length = 390 Score = 360 bits (924), Expect = e-104 Identities = 180/370 (48%), Positives = 253/370 (68%), Gaps = 7/370 (1%) Query: 5 SLGIVETKYYHLEEELKLESGRKISDVTIAYEAYGTLNRDKNNVILVCHALTGDAHAAGW 64 S+GIV + H E LKL +G ++D + E YGTLN ++N +LVCHAL H AG Sbjct: 17 SVGIVAPQCMHFTEPLKLRNGTSLADYDLMVETYGTLNAARSNAVLVCHALNASHHVAGV 76 Query: 65 HKGDNKP-GWWDILIGPGKCLDTDKYFIVCSNVIGGCRGSTGPSSIDPETGKPYGLSFPV 123 ++ D + GWWD ++GPGK LDTD++F++ N +G C GSTGP S +P TG+PYG +FPV Sbjct: 77 YEHDPRDVGWWDNMVGPGKPLDTDRFFVIGVNNLGSCFGSTGPMSANPATGQPYGATFPV 136 Query: 124 ITIKDMVNAQKKLLDHLGISSIYAVIGGSMGGLQVLQWSVSYPDYINKAIALAASAYSSP 183 +T++D VNAQ ++ D GI+ AV+GGS+GG+Q L WS+ YPD + I +A++ S Sbjct: 137 VTVEDWVNAQARVADRFGITQFAAVMGGSLGGMQALAWSLMYPDRLRHCIVVASTPKLSA 196 Query: 184 QQIAFNEVARIAIISDPEWNKGNYY-YSRQPSHGLALARMIGHITYLSDESMREKFGREL 242 Q IAFNEVAR AI+SDP+++ GNYY + +P GL +ARMIGHITYLSDE M EKFGREL Sbjct: 197 QNIAFNEVARSAILSDPDFHGGNYYAHGVKPKRGLRVARMIGHITYLSDEDMAEKFGREL 256 Query: 243 QDRD-RYNYDLSMDFQVESYLHYKGRSFTERFDANSYLYITKAVDYFD--LTENGSLIDG 299 + D R+++D ++FQVESYL Y+G F E FDAN+YL IT+A+DYFD L G L Sbjct: 257 KTDDIRFSFD--VEFQVESYLRYQGDKFAEYFDANTYLLITRALDYFDPALAFGGDLTRA 314 Query: 300 LKDIKAKCLIIAVTSDWLYPPYQSKDIVMALNANNVDVTYREIESNYGHDAFLLEAGQLN 359 + +A L+ + T+DW + P +S+++V AL N V+Y EI++ +GHDAFLL+ + + Sbjct: 315 VSQTQASFLVASFTTDWRFAPNRSRELVKALLDNKRPVSYAEIDAPHGHDAFLLDDPRYH 374 Query: 360 YVIGGFLNNI 369 ++ + I Sbjct: 375 NLMRAYYERI 384 Lambda K H 0.318 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 539 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 390 Length adjustment: 32 Effective length of query: 460 Effective length of database: 358 Effective search space: 164680 Effective search space used: 164680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS01160 RR42_RS01160 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.1251.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-143 464.6 0.0 1.2e-143 464.4 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS01160 RR42_RS01160 homoserine O-acetyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS01160 RR42_RS01160 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.4 0.0 1.2e-143 1.2e-143 2 349 .. 29 380 .. 28 382 .. 0.98 Alignments for each domain: == domain 1 score: 464.4 bits; conditional E-value: 1.2e-143 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgral 68 +e+l+l +G+ l +++++++tyGtlna+r+NavlvcHal +s+hvag ++++ + GWWd+++Gpg++l lcl|FitnessBrowser__Cup4G11:RR42_RS01160 29 TEPLKLRNGTSLADYDLMVETYGTLNAARSNAVLVCHALNASHHVAGVYEHDPRdvGWWDNMVGPGKPL 97 5799*******************************************999887788************* PP TIGR01392 69 dtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSl 137 dt+r+fv+++N+lGsc GstgP+s+np+tg+pyga fP+vt++D+v+aq++++d++g++++aav+GgSl lcl|FitnessBrowser__Cup4G11:RR42_RS01160 98 DTDRFFVIGVNNLGSCFGSTGPMSANPATGQPYGATFPVVTVEDWVNAQARVADRFGITQFAAVMGGSL 166 ********************************************************************* PP TIGR01392 138 GGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalAR 205 GGmqal w+l+yp+r+++++v+a+++++saq+iafnev+r ailsDp++++G+y+ ++ +P++GL++AR lcl|FitnessBrowser__Cup4G11:RR42_RS01160 167 GGMQALAWSLMYPDRLRHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHGvKPKRGLRVAR 235 ********************************************************************* PP TIGR01392 206 mlalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 m++++tY+s+e+++e+fgre k++ ++ +s++ ef+vesylryqg+kf+e FdAn+Yll+t+ald++d lcl|FitnessBrowser__Cup4G11:RR42_RS01160 236 MIGHITYLSDEDMAEKFGRELKTD-DIRFSFDVEFQVESYLRYQGDKFAEYFDANTYLLITRALDYFDP 303 *******************99998.78999*************************************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekek 341 a ++l++a+++++a++lv+++++D++f++++++el+kal ++k yaei+ ++GHDaFll++ + lcl|FitnessBrowser__Cup4G11:RR42_RS01160 304 ALAFGGDLTRAVSQTQASFLVASFTTDWRFAPNRSRELVKALLDNKRPvsYAEIDAPHGHDAFLLDDPR 372 ******************************************99888778******************* PP TIGR01392 342 veeliref 349 +++l+r++ lcl|FitnessBrowser__Cup4G11:RR42_RS01160 373 YHNLMRAY 380 **999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.02 # Mc/sec: 4.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory