Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate RR42_RS30610 RR42_RS30610 cystathionine beta-lyase
Query= SwissProt::P55218 (403 letters) >FitnessBrowser__Cup4G11:RR42_RS30610 Length = 405 Score = 167 bits (424), Expect = 4e-46 Identities = 108/338 (31%), Positives = 170/338 (50%), Gaps = 7/338 (2%) Query: 67 YSRYTNPTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTI 126 Y NPT E+ + LE + SG++A +++ G HVL+ V+ Sbjct: 57 YGARGNPTAFALEDMVTELEAGYRTRLFPSGLAAAAMTLLAYLRPGQHVLLPDCVYEPVR 116 Query: 127 SLFDKYFKRFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHA 186 L + + + GI + +D +A + T+L +VE+P + E+ D+ A+A+IAH Sbjct: 117 KLAEGFLAQHGIAASFYA-ADGHDLQARLRRETRLVYVEAPGSLAYEMCDLPAIADIAHR 175 Query: 187 KGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVGFL 246 GAL+A DN + + L QPL LGAD+ + +ATKY+ G M G V + Sbjct: 176 HGALVAADNTWGSGLLYQPLALGADISLMAATKYLSGHSDVMMGTVCTLEAAWPALAAVA 235 Query: 247 RTAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQH 306 G ++SP +A+L +G+ +L R+ H SALA+A WL +P + V+ LP P H Sbjct: 236 DAFGISVSPDDAYLVQRGMRSLGARLSQHERSALAVAHWLRTRPEVAEVFCPALPGDPGH 295 Query: 307 ELARRQQSGFGAVVSFDVKG-GRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRL 365 L +R G ++SF ++ DAA RFID+ + I + G ++ G Sbjct: 296 ALWQRDCHGTNGLLSFALRAVAPDAAERFIDSLALFGIGASWGGFESLAV--IADMRGAR 353 Query: 366 SPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403 S D + G +IR+ +GLED+DDL AD+ARG + Sbjct: 354 SVTDWSGRG---QVIRLHIGLEDVDDLLADLARGFEVI 388 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 405 Length adjustment: 31 Effective length of query: 372 Effective length of database: 374 Effective search space: 139128 Effective search space used: 139128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory