GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Cupriavidus basilensis 4G11

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate RR42_RS01125 RR42_RS01125 acetylglutamate kinase

Query= BRENDA::Q9HTN2
         (301 letters)



>FitnessBrowser__Cup4G11:RR42_RS01125
          Length = 305

 Score =  336 bits (862), Expect = 3e-97
 Identities = 170/285 (59%), Positives = 218/285 (76%), Gaps = 5/285 (1%)

Query: 12  AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71
           A++L+EALPYIR+F GKT+V+KYGGNAM  E+LK GFARDV+L+K VG+NPVVVHGGGPQ
Sbjct: 22  AEILAEALPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQ 81

Query: 72  IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131
           I + LK++     FI GMRVTD  TM+VVE VLGG+V +DIV LIN++GG A+GLTGKD 
Sbjct: 82  IDEALKKVGKVGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDG 141

Query: 132 ELIRAKKLTVTRQTPEMTKP-EIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSN 190
            LIRAK+L    + P+   P   IDIG VG++  +N  ++  L    FIPVI+PIG   +
Sbjct: 142 GLIRAKRL----KMPDRESPGAFIDIGFVGDIEAINPAVVKALQDDAFIPVISPIGFSDD 197

Query: 191 GESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYG 250
           G++YNINAD+VAGK+AE LKAEKL+++TNI G+MDK G +LT LS  ++ EL ADGTI G
Sbjct: 198 GQAYNINADVVAGKMAEILKAEKLVMMTNIPGVMDKAGNLLTDLSAREIEELFADGTISG 257

Query: 251 GMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295
           GMLPKI  AL+A + GV S HIIDGR+ +++LLEI T+   GT+I
Sbjct: 258 GMLPKISSALDAAKSGVNSVHIIDGRIEHSLLLEILTEQAFGTMI 302


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 336
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 305
Length adjustment: 27
Effective length of query: 274
Effective length of database: 278
Effective search space:    76172
Effective search space used:    76172
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate RR42_RS01125 RR42_RS01125 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.21107.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.21107.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.