Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate RR42_RS27010 RR42_RS27010 D-3-phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >FitnessBrowser__Cup4G11:RR42_RS27010 Length = 403 Score = 359 bits (922), Expect = e-103 Identities = 188/396 (47%), Positives = 257/396 (64%) Query: 234 NVLLLENVHPIGVEIMKQEGYNVEVVSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLEN 293 + LLLEN+H VE K+ VE + A++ +EL I+GIRS T + +E Sbjct: 3 SALLLENIHDTAVERFKEAHVTVERRTGALAGDELHRAPAAHQILGIRSATHLGAAEIEA 62 Query: 294 ANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTL 353 A L+A+G FCIGT+Q+DL+ G+ VFNAPFSNTRSV EL I+E I L+R + +K Sbjct: 63 ARHLVAIGCFCIGTSQVDLDAAARAGMPVFNAPFSNTRSVAELVIAEAILLLRRVPEKNA 122 Query: 354 KMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYDIVERLALGNAT 413 H G W K ASGSFE RGK + IIGYGNIG+Q+ VLAE MGM V YYD+ +L+LG+A Sbjct: 123 LAHAGKWAKGASGSFEARGKTIAIIGYGNIGSQVGVLAEAMGMRVVYYDVQAKLSLGSAR 182 Query: 414 KIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPALRDA 473 SL + + DI++LHV + + +++ + + + ++GAIL+N SRG VVD+ ALR A Sbjct: 183 AARSLADAVSQADIVTLHVPATAQTRKMIDADVLRQFRRGAILINASRGTVVDIEALRAA 242 Query: 474 LESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVPGKI 533 + H+AG A+DVFP EPK N + F S L G PN ILTPHIGGST EAQENI V K+ Sbjct: 243 CDDNHIAGLAIDVFPEEPKTNADRFTSPLQGVPNAILTPHIGGSTEEAQENIGTEVATKL 302 Query: 534 IEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASYKINIVGQYLK 593 I ++ +G+T +VNFP + L RL+++H NAPG LA +N +LA +NIV Q+L+ Sbjct: 303 IAFLRTGDTIGAVNFPEVSPGPLTSPARLLNVHGNAPGALAALNTLLARDGVNIVAQHLQ 362 Query: 594 TNEKIGYVITDIDKRYSNDVIDALKEIEGTIRFRIL 629 T+ ++GYV+TD+DK S + AL IR R + Sbjct: 363 THGQMGYVVTDLDKVPSPTLAAALDAETTFIRCRTI 398 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 403 Length adjustment: 34 Effective length of query: 596 Effective length of database: 369 Effective search space: 219924 Effective search space used: 219924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory