Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate RR42_RS04455 RR42_RS04455 MFS transporter
Query= CharProtDB::CH_002572 (362 letters) >lcl|FitnessBrowser__Cup4G11:RR42_RS04455 RR42_RS04455 MFS transporter Length = 386 Score = 362 bits (929), Expect = e-105 Identities = 186/365 (50%), Positives = 247/365 (67%), Gaps = 9/365 (2%) Query: 3 QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLN 62 +++NFS GPA LP EVL QA E+ W+G G SVME+SHR +EF + EA + R+LL Sbjct: 20 RVYNFSPGPAALPTEVLLQAADEMLSWHGSGVSVMEMSHRSREFESIQAEALANLRELLQ 79 Query: 63 VPSNYKVLFCHGGGRGQFAAVPLNIL----GDKTTADYVDAGYWAASAIKEAKKYCTPNV 118 VP N+++LF GG G+ VPLN++ D+ AD+V G W+ + +EA++Y N+ Sbjct: 80 VPKNFRILFLQGGAIGENGIVPLNLMRRVNADRPKADFVVTGTWSVKSEQEARRYGEVNI 139 Query: 119 FDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFG----ADVVVAAD 174 A T + + +W+LSD+AAY+H C NETI G+ + PD G VV AD Sbjct: 140 A-ATSTAQKFARIPDVADWKLSDDAAYVHLCTNETIVGVEFQDVPDIGQHRDGGPVVVAD 198 Query: 175 FSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDN 234 SS ILSRP+D SR V Y GAQKNIGPAGLTIVIVREDLLG A+ CPS ++ ++ ++ Sbjct: 199 VSSHILSRPVDWSRVQVAYGGAQKNIGPAGLTIVIVREDLLGHAHPLCPSAFNWRLVAEH 258 Query: 235 GSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKAN 294 SM+NTPPT++ Y++GLVFKWLKA GGV +++ N K+ LY +D S FYRN++ + Sbjct: 259 DSMYNTPPTYSIYIAGLVFKWLKAQGGVGAIEQRNIAKSHALYEFLDQSAFYRNEIDPGS 318 Query: 295 RSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFM 354 RSRMNVPF LAD + + FL + A GL LKGH+ VGGMRAS+YNAMP+EGV AL ++M Sbjct: 319 RSRMNVPFFLADESRNDAFLAGARANGLVQLKGHKSVGGMRASLYNAMPIEGVAALIEYM 378 Query: 355 VEFER 359 EFER Sbjct: 379 REFER 383 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 386 Length adjustment: 30 Effective length of query: 332 Effective length of database: 356 Effective search space: 118192 Effective search space used: 118192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS04455 RR42_RS04455 (MFS transporter)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.13232.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-147 477.3 0.0 1.4e-147 477.2 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS04455 RR42_RS04455 MFS transporter Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS04455 RR42_RS04455 MFS transporter # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 477.2 0.0 1.4e-147 1.4e-147 1 356 [. 21 383 .. 21 385 .. 0.98 Alignments for each domain: == domain 1 score: 477.2 bits; conditional E-value: 1.4e-147 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 ++nFs+GPaalp+evl +a++e+l ++g+g+svme+sHRs+efe++ ea +lreLl++p+n+++lfl lcl|FitnessBrowser__Cup4G11:RR42_RS04455 21 VYNFSPGPAALPTEVLLQAADEMLSWHGSGVSVMEMSHRSREFESIQAEALANLRELLQVPKNFRILFL 89 59******************************************************************* PP TIGR01364 70 qGGattqfaavplnllkekk....vadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeel 134 qGGa ++ vplnl+++ + +ad++vtG+ws k+ +ea+++++ v+++a++ +k+ +ipd ++ lcl|FitnessBrowser__Cup4G11:RR42_RS04455 90 QGGAIGENGIVPLNLMRRVNadrpKADFVVTGTWSVKSEQEARRYGE-VNIAATSTAQKFARIPDVADW 157 ****************955445679********************98.*******99************ PP TIGR01364 135 elkedaayvylcanetieGvefkelpevkk.....aplvaDlssdilsrkidvskygliyaGaqKniGp 198 +l++daayv+lc+neti Gvef+++p+ + ++vaD+ss+ilsr++d s+ ++ y+GaqKniGp lcl|FitnessBrowser__Cup4G11:RR42_RS04455 158 KLSDDAAYVHLCTNETIVGVEFQDVPDIGQhrdggPVVVADVSSHILSRPVDWSRVQVAYGGAQKNIGP 226 **************************999878888899******************************* PP TIGR01364 199 aGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqe 267 aG+t+vivr+dll++a+ +ps ++++ +ae+ds+yntppt++iy++glv+kwlk++GGv ++e++n + lcl|FitnessBrowser__Cup4G11:RR42_RS04455 227 AGLTIVIVREDLLGHAHPLCPSAFNWRLVAEHDSMYNTPPTYSIYIAGLVFKWLKAQGGVGAIEQRNIA 295 ********************************************************************* PP TIGR01364 268 KakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiY 336 K++ lYe +d+s fy+n++++ +Rs+mnv+F l++e ++ Fl+ a+++glv+lkGh+svGG+Ras+Y lcl|FitnessBrowser__Cup4G11:RR42_RS04455 296 KSHALYEFLDQSA-FYRNEIDPGSRSRMNVPFFLADESRNDAFLAGARANGLVQLKGHKSVGGMRASLY 363 **********996.******************************************************* PP TIGR01364 337 nalpleevqaLvdfmkeFek 356 na+p+e+v aL+++m+eFe+ lcl|FitnessBrowser__Cup4G11:RR42_RS04455 364 NAMPIEGVAALIEYMREFER 383 ******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.20 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory