Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate RR42_RS32495 RR42_RS32495 shikimate kinase
Query= metacyc::MONOMER-21144 (185 letters) >FitnessBrowser__Cup4G11:RR42_RS32495 Length = 170 Score = 74.3 bits (181), Expect = 1e-18 Identities = 52/153 (33%), Positives = 77/153 (50%), Gaps = 3/153 (1%) Query: 28 GAGKTTVGRELALQLGWAHVDTDNLIEATYGTRLQAVADSMDKESFLDVEAGVIRRIGAR 87 GAGKTT+GR +A +LG D+D+ IEA G R+ + + +E F + E+ V+ + R Sbjct: 2 GAGKTTIGRTVARRLGLPFFDSDHEIEARCGVRIPTIFELEGEEGFRERESRVLDELSQR 61 Query: 88 R-TVLSTGGSVVYRHEAMAHLAALGPLVYLDVSLPLILKRIAMNPDRGL--AIAPGQTIE 144 R V++TGG V R E L + G ++YL S + R N +R L P T+E Sbjct: 62 RGIVMATGGGAVLRPENREMLRSRGCVIYLCASPAELWHRTRRNRNRPLLQVANPRATLE 121 Query: 145 DLYNERIALYRRYATFTVAADALSPGGCATRIV 177 L+ R LYR A + S A R++ Sbjct: 122 ALFQVRDPLYRETAHLIMPPHGDSVANAAGRVL 154 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 185 Length of database: 170 Length adjustment: 19 Effective length of query: 166 Effective length of database: 151 Effective search space: 25066 Effective search space used: 25066 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory