Align phosphoribosylanthranilate isomerase; EC 5.3.1.24 (characterized)
to candidate RR42_RS14365 RR42_RS14365 N-(5'-phosphoribosyl)anthranilate isomerase
Query= CharProtDB::CH_021917 (235 letters) >FitnessBrowser__Cup4G11:RR42_RS14365 Length = 233 Score = 243 bits (621), Expect = 2e-69 Identities = 140/229 (61%), Positives = 157/229 (68%), Gaps = 16/229 (6%) Query: 17 AVPPRTRIKLCGLSRPDDVLHAAALGADAIGLVFYAKSPRAVTIAQAAELARLAPPFVSV 76 +VP RTRIK+CGL+R +DV A GADAIGLVFY SPR V +A+AA LA A PFVSV Sbjct: 9 SVPRRTRIKICGLTREEDVRAAVDAGADAIGLVFYPGSPRFVEVARAAALAEAAGPFVSV 68 Query: 77 VGLFVNATAAEIEAVVRDVPLTLLQFHGDETPEQCDALGRAARLPWVRAVRVGPSTQSAD 136 VGLFVNA A I VV VPLTLLQFHGDE PE C + + RLP++RA RV P D Sbjct: 69 VGLFVNAEADHIAHVVERVPLTLLQFHGDERPEDCTLVAQRCRLPFLRAARVQP---GLD 125 Query: 137 LVESSLHYSKARGLLFDTLVPDYGGSGKVFDWSLIP-----------AELARRAVLSGGL 185 LVE + + A LL D V YGG G VFDW+LIP A A R VLSGGL Sbjct: 126 LVEFADLHRDAAALLLDAFVEGYGGGGHVFDWTLIPPTWLAPTHNPTASAAPRIVLSGGL 185 Query: 186 NAQNVGDAIRQLRPFAVDVSSGIEVEGAKGVKDHARMAAFVRAVRDADA 234 NAQNV AI ++RP+AVDVSSG VE AKGVKDHAR+AAFVRAVR ADA Sbjct: 186 NAQNVAGAIERVRPYAVDVSSG--VEAAKGVKDHARIAAFVRAVRSADA 232 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 233 Length adjustment: 23 Effective length of query: 212 Effective length of database: 210 Effective search space: 44520 Effective search space used: 44520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory