Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate RR42_RS18305 RR42_RS18305 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__Cup4G11:RR42_RS18305 Length = 342 Score = 485 bits (1249), Expect = e-142 Identities = 245/340 (72%), Positives = 281/340 (82%) Query: 1 MPITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGA 60 M ITPQ+AL R IEHREIFHDEM+ LMRQIM+G++S M +AILTGLRVKKETIGEI+ A Sbjct: 1 MSITPQEALTRCIEHREIFHDEMLHLMRQIMQGQMSPVMAAAILTGLRVKKETIGEISAA 60 Query: 61 ATVMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSS 120 A VMREF+ +V V DR + VDIVGTGGDGSHTFNIST +MFVA+A GA++AKHGNR VSS Sbjct: 61 AQVMREFANKVPVKDRENFVDIVGTGGDGSHTFNISTASMFVASAAGARIAKHGNRGVSS 120 Query: 121 KSGSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFN 180 KSGSAD LEALG I L PEQV + QTGIGFM+AP HHPAMK VAP+R+EMGVRTIFN Sbjct: 121 KSGSADVLEALGVNIMLTPEQVGQCIEQTGIGFMFAPTHHPAMKNVAPIRKEMGVRTIFN 180 Query: 181 ILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVG 240 ILGPLTNPA +PNILMGVFHPDLVGIQ RV+Q LGA ALVV+G+DGMDE+SLGA TLVG Sbjct: 181 ILGPLTNPADAPNILMGVFHPDLVGIQVRVMQRLGARHALVVYGKDGMDEVSLGAATLVG 240 Query: 241 ELRDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGA 300 EL+DG+V EYEVHPEDFG+ M ++R LKVADA ES+ MLL+ L +VPG +IV LNAG Sbjct: 241 ELKDGEVREYEVHPEDFGLQMISNRGLKVADATESKEMLLEALTDVPGTPREIVTLNAGT 300 Query: 301 ALYVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQ 340 ALY A VA SI DGI RAR+ +A G+AR LD +V TQQ Sbjct: 301 ALYAANVASSIEDGIQRAREAIASGAAREKLDQFVRATQQ 340 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 342 Length adjustment: 29 Effective length of query: 316 Effective length of database: 313 Effective search space: 98908 Effective search space used: 98908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS18305 RR42_RS18305 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.1254.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-131 422.9 1.7 5.4e-131 422.7 1.7 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS18305 RR42_RS18305 anthranilate phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS18305 RR42_RS18305 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.7 1.7 5.4e-131 5.4e-131 2 329 .. 10 336 .. 9 337 .. 0.99 Alignments for each domain: == domain 1 score: 422.7 bits; conditional E-value: 5.4e-131 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 ++++++++ ++e+ +lm++im+g++s++ aAil+ lrvk et+ ei+++a+++re a+kv+++++e+ lcl|FitnessBrowser__Cup4G11:RR42_RS18305 10 TRCIEHREIFHDEMLHLMRQIMQGQMSPVMAAAILTGLRVKKETIGEISAAAQVMREFANKVPVKDREN 78 6899***************************************************************** PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsle 139 +vDivGTGGDg++t+NiSTas++va+aaG+++aKhGnr vssksGsaDvLealgvn+ l+pe+v +++e lcl|FitnessBrowser__Cup4G11:RR42_RS18305 79 FVDIVGTGGDGSHTFNISTASMFVASAAGARIAKHGNRGVSSKSGSADVLEALGVNIMLTPEQVGQCIE 147 ********************************************************************* PP TIGR01245 140 evgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgv 208 ++gigF+fAP++hpa+k+vap+Rke+gvrt+fN+LGPL+nPa a++ ++Gv+++dlv + ++v+++lg+ lcl|FitnessBrowser__Cup4G11:RR42_RS18305 148 QTGIGFMFAPTHHPAMKNVAPIRKEMGVRTIFNILGPLTNPADAPNILMGVFHPDLVGIQVRVMQRLGA 216 ********************************************************************* PP TIGR01245 209 kralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevleg 277 ++alvv g+dg+DE+sl + t v elkdge++ey+++pedfgl++ + + lk+++a e+ e+l e+l+ lcl|FitnessBrowser__Cup4G11:RR42_RS18305 217 RHALVVYGKDGMDEVSLGAATLVGELKDGEVREYEVHPEDFGLQMISNRGLKVADATESKEMLLEALTD 285 ********************************************************************9 PP TIGR01245 278 kekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 + r+iv lNa++aly+a++a+++++g+++a+eai sg+a ekl+++v+ lcl|FitnessBrowser__Cup4G11:RR42_RS18305 286 VP-GTPREIVTLNAGTALYAANVASSIEDGIQRAREAIASGAAREKLDQFVR 336 98.6779*****************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory