GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cmutase in Cupriavidus basilensis 4G11

Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate RR42_RS04460 RR42_RS04460 chorismate mutase

Query= SwissProt::P27603
         (365 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS04460 RR42_RS04460 chorismate
           mutase
          Length = 379

 Score =  332 bits (852), Expect = 8e-96
 Identities = 169/358 (47%), Positives = 235/358 (65%), Gaps = 6/358 (1%)

Query: 6   QLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIM 65
           +L  LR +ID+LD  +L +++ RA+ A +V  VK     K   A  +RPERE  V++ + 
Sbjct: 27  ELTPLREQIDTLDRELLAMLNRRAQLALDVGEVK-----KKYGAPVFRPERELQVIRKVQ 81

Query: 66  ELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125
             N GPL ++ +A ++RE+MS+C  LE+PL VA+LGP GTFS+ A   HFGH V   P  
Sbjct: 82  GANPGPLLDDSVAAIWREVMSACRGLEKPLEVAFLGPAGTFSEQALYAHFGHEVSGVPCP 141

Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185
           +IDEVFR V AG V +GVVPVENSTEGAV+ TLD FL+  + I GE+ L++HH+L+    
Sbjct: 142 SIDEVFRAVEAGTVEYGVVPVENSTEGAVSRTLDLFLQTSLKISGEIALKVHHNLMASSP 201

Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245
                +T + +HAQ+LAQC+ WL A+YP++ER AVSSNA+AA+    +   AAIAG+ AA
Sbjct: 202 DMKG-VTVVRAHAQALAQCQHWLTANYPHLERQAVSSNAEAARMASEDPTVAAIAGESAA 260

Query: 246 QLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHS 305
             Y L  +   I+D P N TRF +IG  E  P+G D+TS+I+S+ NK GA+++LL P   
Sbjct: 261 NRYHLHLVRTHIQDDPHNRTRFAVIGRYETEPSGSDQTSMILSVPNKAGAVYQLLAPLAD 320

Query: 306 NGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363
           NG+ + R E+RP+RSG W Y F++D  GH  D  +   LE++   A   KVLGSYP +
Sbjct: 321 NGVSMCRFESRPARSGAWEYYFYVDVEGHQHDASVARALEELRRNAAYFKVLGSYPSS 378


Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 332
Number of extensions: 8
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 365
Length of database: 379
Length adjustment: 30
Effective length of query: 335
Effective length of database: 349
Effective search space:   116915
Effective search space used:   116915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate RR42_RS04460 RR42_RS04460 (chorismate mutase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01807.hmm
# target sequence database:        /tmp/gapView.8323.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01807  [M=76]
Accession:   TIGR01807
Description: CM_P2: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    5.2e-31   93.1   0.1    9.5e-31   92.2   0.1    1.5  1  lcl|FitnessBrowser__Cup4G11:RR42_RS04460  RR42_RS04460 chorismate mutase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS04460  RR42_RS04460 chorismate mutase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.2   0.1   9.5e-31   9.5e-31       1      76 []      28     101 ..      28     101 .. 0.98

  Alignments for each domain:
  == domain 1  score: 92.2 bits;  conditional E-value: 9.5e-31
                                 TIGR01807   1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeava 69 
                                               L++lR++iD++D ++l +l+ Ra+la +vge+Kkk   +a+++RPeRE++v+r+++++n+GpL +++va
  lcl|FitnessBrowser__Cup4G11:RR42_RS04460  28 LTPLREQIDTLDRELLAMLNRRAQLALDVGEVKKK--YGAPVFRPERELQVIRKVQGANPGPLLDDSVA 94 
                                               789********************************..899999************************** PP

                                 TIGR01807  70 rifrEim 76 
                                               +i+rE+m
  lcl|FitnessBrowser__Cup4G11:RR42_RS04460  95 AIWREVM 101
                                               ******9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (76 nodes)
Target sequences:                          1  (379 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 7.71
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory