GapMind for Amino acid biosynthesis

 

Aligments for a candidate for pre-dehydr in Cupriavidus basilensis 4G11

Align prephenate dehydrogenase (EC 1.3.1.12); prephenate dehydratase (EC 4.2.1.51); Chorismate mutase (EC 5.4.99.5) (characterized)
to candidate RR42_RS04460 RR42_RS04460 chorismate mutase

Query= BRENDA::O30012
         (620 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS04460 RR42_RS04460 chorismate
           mutase
          Length = 379

 Score =  165 bits (418), Expect = 3e-45
 Identities = 115/364 (31%), Positives = 191/364 (52%), Gaps = 18/364 (4%)

Query: 259 ATKKAESIE--ELRGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEEEKLW 316
           A +KA  +E   LR  I ++D  +L ++ RR   A  +  +K + G P+   + E + + 
Sbjct: 19  AAEKALGVELTPLREQIDTLDRELLAMLNRRAQLALDVGEVKKKYGAPVFRPERELQVIR 78

Query: 317 EVMSKTTLNPVKLKEIFEGIMSLAKEEEYKVAGVK--YTIAVLGPQGSFSEEMALKLVGS 374
           +V      NP  L +  + + ++ +E      G++    +A LGP G+FSE+      G 
Sbjct: 79  KVQGA---NPGPLLD--DSVAAIWREVMSACRGLEKPLEVAFLGPAGTFSEQALYAHFGH 133

Query: 375 RVPLRYCSTTDEIIKLVESGEVDYGLVPIENSVNGTVLPVIDALLNHDVEVFGEAKLEVN 434
            V    C + DE+ + VE+G V+YG+VP+ENS  G V   +D  L   +++ GE  L+V+
Sbjct: 134 EVSGVPCPSIDEVFRAVEAGTVEYGVVPVENSTEGAVSRTLDLFLQTSLKISGEIALKVH 193

Query: 435 HCLVAKRKIELKEIKTIYSHPQAVAQCMGFINNYLPSVAIRYTTSTSDAARML--DDYSA 492
           H L+A    ++K +  + +H QA+AQC  ++    P +  +  +S ++AARM   D   A
Sbjct: 194 HNLMASSP-DMKGVTVVRAHAQALAQCQHWLTANYPHLERQAVSSNAEAARMASEDPTVA 252

Query: 493 AIMSENAARFYRLHVLRKGIQDLKGRNITRFYLIRRRSGRSEGK-ITSLFFGVEDKPGAL 551
           AI  E+AA  Y LH++R  IQD    N TRF +I R      G   TS+   V +K GA+
Sbjct: 253 AIAGESAANRYHLHLVRTHIQD-DPHNRTRFAVIGRYETEPSGSDQTSMILSVPNKAGAV 311

Query: 552 KDVLEVFHKKGFNLRKLESRPAGTGLGDYVFFVEVEAPLREED----LLDLKQVTTFYKV 607
             +L      G ++ + ESRPA +G  +Y F+V+VE    +      L +L++   ++KV
Sbjct: 312 YQLLAPLADNGVSMCRFESRPARSGAWEYYFYVDVEGHQHDASVARALEELRRNAAYFKV 371

Query: 608 VGVF 611
           +G +
Sbjct: 372 LGSY 375


Lambda     K      H
   0.320    0.137    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 391
Number of extensions: 23
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 620
Length of database: 379
Length adjustment: 34
Effective length of query: 586
Effective length of database: 345
Effective search space:   202170
Effective search space used:   202170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory