Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Asp/Glu-ADT subunit B; EC 6.3.5.- (characterized)
to candidate 3607799 Dshi_1207 glutamyl-tRNA(Gln) amidotransferase, B subunit (RefSeq)
Query= SwissProt::Q9RF06 (475 letters) >FitnessBrowser__Dino:3607799 Length = 505 Score = 395 bits (1016), Expect = e-114 Identities = 208/483 (43%), Positives = 303/483 (62%), Gaps = 14/483 (2%) Query: 3 FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRA 62 +E VIGLEVH ++ T++K+FS + FGAEPNSN +D PG+LPV+N+ V A+R Sbjct: 21 WELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDAGMPGMLPVINEECVAQAVRT 80 Query: 63 AMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRL 121 + L I S FDRKNYFYPD P+ YQISQ PI G + +E+ DG + + I R+ Sbjct: 81 GLGLKAAINLTSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELGDGTARVVRIERI 140 Query: 122 HMEEDAGKSTHKGE--YSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGV 179 H+E+DAGKS H + S VDLNR G L+EIVS PDIR P+EA AY+ KLR I++Y G Sbjct: 141 HLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVSRPDIRGPEEAAAYVSKLRQIMRYLGT 200 Query: 180 SDVKMEEGSLRCDANISL-RPYGQEKF---------GTKAELKNLNSFNYVRKGLEYEEK 229 D M+ G+LR D N+S+ RP EK+ GT+ E+KN+NS ++++ +EYE + Sbjct: 201 CDGNMQNGNLRADVNVSVCRPGDYEKYQASQDFSHLGTRCEIKNMNSLRFIQQAIEYEAR 260 Query: 230 RQEEELLSGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVR 289 RQ + GG + QETR +D G+T MR KE + DYRYFP+PD++PL I+ AW + + Sbjct: 261 RQIAIIEDGGSVTQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEIEQAWVDDIA 320 Query: 290 QTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVN 349 +PELPD +KA+++ E GL YDA VLT + +FE+ D KL +NW++ + Sbjct: 321 AALPELPDAKKARFITEFGLSDYDASVLTADTTNAAYFEAVAGEAGDGKLAANWVINELF 380 Query: 350 EYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGL 409 L K ++ ++ ++P LAG+IKLI+ +S KIAK +F + +GG+ +I+E G+ Sbjct: 381 GRLKKEDHDITESPVSPAQLAGIIKLIKADAISGKIAKDLFEIVYTEGGDPAEIVEARGM 440 Query: 410 VQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLK 469 Q++D + V+E + N V + K G+ VGQ+MKA+ G+ANP+ VNQ++ Sbjct: 441 KQVTDTGAIEAAVDEIIAANPAQVAKAQENP-KLAGWFVGQVMKATGGKANPKAVNQIVA 499 Query: 470 QEL 472 +L Sbjct: 500 AKL 502 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 505 Length adjustment: 34 Effective length of query: 441 Effective length of database: 471 Effective search space: 207711 Effective search space used: 207711 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.6 bits)
Align candidate 3607799 Dshi_1207 (glutamyl-tRNA(Gln) amidotransferase, B subunit (RefSeq))
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.17134.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-164 532.6 0.0 4.7e-164 532.4 0.0 1.0 1 lcl|FitnessBrowser__Dino:3607799 Dshi_1207 glutamyl-tRNA(Gln) ami Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3607799 Dshi_1207 glutamyl-tRNA(Gln) amidotransferase, B subunit (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 532.4 0.0 4.7e-164 4.7e-164 2 480 .. 19 502 .. 18 503 .. 0.95 Alignments for each domain: == domain 1 score: 532.4 bits; conditional E-value: 4.7e-164 TIGR00133 2 ieyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalnskivsevsv 78 +++elviGlEvH q+ t++KlF+ +s+ + +pN+nv v+ g+PG lPv+N+e v++A+ +l l++ i+ +s lcl|FitnessBrowser__Dino:3607799 19 EDWELVIGLEVHAQVATNAKLFSGASTLFGA-EPNSNVAFVDAGMPGMLPVINEECVAQAVRTGLGLKAAIN-LTSA 93 5789*************************99.**************************************76.59** PP TIGR00133 79 FdRKhYfYpDlPkgyqitqqdlPiaedGkleieleeke.keigierlhlEeDtgksqykesdkdkqslvDfNRsgvP 154 FdRK+YfYpDlP+gyqi+q + Pi+ +G++ +el ++ + ++ier+hlE+D+gks + + +++s+vD+NR+gv lcl|FitnessBrowser__Dino:3607799 94 FDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELGDGTaRVVRIERIHLEQDAGKSIHDMD--PHMSFVDLNRTGVA 168 *********************************977654999****************976..78************ PP TIGR00133 155 LlEiVtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvsirlkGq..........ekegtrvEiKNl 221 L+EiV++Pd++ ++ea+a+++klrqi+ryl+ dg++++G++R+DvNvs+ G+ ++ gtr EiKN+ lcl|FitnessBrowser__Dino:3607799 169 LMEIVSRPDIRGPEEAAAYVSKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDyekyqasqdfSHLGTRCEIKNM 245 **************************************************87765222222222245689******* PP TIGR00133 222 nslksiekaieyEieRqkkllkkgeevkqetrafdekksitvslRkKeeseDYRYfpePdlppieideevvkekvee 298 nsl+ i++aieyE Rq++++++g +v+qetr +d k t s+R+Kee++DYRYfp+Pdl p+ei++ +v++ +++ lcl|FitnessBrowser__Dino:3607799 246 NSLRFIQQAIEYEARRQIAIIEDGGSVTQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEIEQAWVDD-IAA 321 ************************************************************************9.*** PP TIGR00133 299 klpelPeakrirlkkeyglseedakvlvsdlelldafeevvklikepklavnWileellgeLnkkkislaeallkpe 375 lpelP+ak++r+ +e+gls++da vl++d++ + +fe v+ +++ kla+nW+++el g+L+k++ +++e+ ++p lcl|FitnessBrowser__Dino:3607799 322 ALPELPDAKKARFITEFGLSDYDASVLTADTTNAAYFEAVAGEAGDGKLAANWVINELFGRLKKEDHDITESPVSPA 398 ***************************************************************************** PP TIGR00133 376 elaeliklikegkisqksakelleellenkkdpkklieklgliqisdekelvkiveevikenpkevekyksgkekal 452 +la +iklik++ is+k+ak+l+e + ++++dp +++e++g+ q++d+ ++ ++v+e+i+ np +v k +++ k+ lcl|FitnessBrowser__Dino:3607799 399 QLAGIIKLIKADAISGKIAKDLFEIVYTEGGDPAEIVEARGMKQVTDTGAIEAAVDEIIAANPAQVAKAQEN-PKLA 474 ******************************************************************998765.6788 PP TIGR00133 453 kflvGqvmkktkgradpkevekllkell 480 +++vGqvmk t g+a+pk v++++ +l lcl|FitnessBrowser__Dino:3607799 475 GWFVGQVMKATGGKANPKAVNQIVAAKL 502 9**********************98877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (505 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 10.95 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory