Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate 3608203 Dshi_1608 3-dehydroquinate synthase (RefSeq)
Query= SwissProt::U3KRF2 (445 letters) >FitnessBrowser__Dino:3608203 Length = 383 Score = 274 bits (700), Expect = 4e-78 Identities = 166/374 (44%), Positives = 218/374 (58%), Gaps = 9/374 (2%) Query: 74 TKAVSSAPTIVDVDLGDRSYPIYIGSGLLDQPDL-LQRHVHGKRVLVVTNSTVAPIYLDK 132 T + + AP V V L DR+Y + IG GLL Q + + +V +V++ TVA ++L Sbjct: 2 TMSAAPAPQTVYVPLEDRAYDVVIGPGLLAQAGARISPFLPRPKVAIVSDETVAALHLAT 61 Query: 133 VVGALTNGNPNVSVESVILPDGEKYKNMDTLMKVFDKAIESRLDRRCTFVALGGGVIGDM 192 + +L + ++ILP GE K + D + +++RR +A GGGVIGD+ Sbjct: 62 LQDSLATAG--IDSTALILPAGEATKGWPEFSRTVDWLLAQKIERRDLVIAFGGGVIGDL 119 Query: 193 CGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTL 252 G+AAA RGV FIQIPT+++AQVDSSVGGKTGIN GKNLIGAF+QP+ VL DTD L Sbjct: 120 VGFAAAVLRRGVGFIQIPTSLLAQVDSSVGGKTGINSVHGKNLIGAFHQPRLVLADTDVL 179 Query: 253 NTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMPALMARDPSALAYAIKRSCENKAEVV 312 TL R+ +G EVVKYGL+ DA+FF W E P L A D SA A++RS E KAE+V Sbjct: 180 GTLTPRDFLAGYGEVVKYGLLGDADFFAWLETEGPRLAAGDGSARVAAVRRSVEMKAEIV 239 Query: 313 SLDEKESGLRATLNLGHTFGHAIETGFGYG-QWLHGEAVAAGMVMAVDMSYRLGWIDESI 371 DE E G RA LNLGHTF HA+E GY + LHGE VA G +A D+S RLG + Sbjct: 240 VRDETEQGDRALLNLGHTFCHALEAATGYSDRLLHGEGVAIGCALAFDLSARLGLCAQED 299 Query: 372 VNRAHNILQ----QAKLPTAPPETMTVEMFKSVMAVDKKVADGLLRLILLKGPLGNCVFT 427 +R LQ + L + E ++M DKKV DG LR IL +G +G T Sbjct: 300 PSRVRAHLQTMGMKRDLRDIAGDLPDAEALLNLMGQDKKVMDGTLRFILARG-IGQAFMT 358 Query: 428 GDYDRKALDETLHA 441 + +A+ L A Sbjct: 359 SEVPSEAVLSVLRA 372 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 383 Length adjustment: 31 Effective length of query: 414 Effective length of database: 352 Effective search space: 145728 Effective search space used: 145728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3608203 Dshi_1608 (3-dehydroquinate synthase (RefSeq))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.22205.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-108 349.3 0.0 1.3e-108 349.2 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608203 Dshi_1608 3-dehydroquinate synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608203 Dshi_1608 3-dehydroquinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 349.2 0.0 1.3e-108 1.3e-108 1 341 [. 21 368 .. 21 371 .. 0.97 Alignments for each domain: == domain 1 score: 349.2 bits; conditional E-value: 1.3e-108 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldql 75 y+v++g gll+++ + ++ + k+ +++de+v++l+ ++l++ l+++g+ + l++p+ge +K + ++++++d+l lcl|FitnessBrowser__Dino:3608203 21 YDVVIGPGLLAQAGARISPflPRPKVAIVSDETVAALHLATLQDSLATAGIDSTALILPAGEATKGWPEFSRTVDWL 97 789***************9854589**************************************************** PP TIGR01357 76 leeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVli 152 l++k+er+++++a+GGGv+gDl+GF+Aa+ RG+ ++q+PT+lla+vDssvGGKtgin +gkNliGaf+qP++Vl lcl|FitnessBrowser__Dino:3608203 98 LAQKIERRDLVIAFGGGVIGDLVGFAAAVLRRGVGFIQIPTSLLAQVDSSVGGKTGINSVHGKNLIGAFHQPRLVLA 174 ***************************************************************************** PP TIGR01357 153 dlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglRa 229 d++vl tl+ r + +G++Ev+K+gl+ da++f++le+ l + +a +++rs+e+Kae+V +De+e+g Ra lcl|FitnessBrowser__Dino:3608203 175 DTDVLGTLTPRDFLAGYGEVVKYGLLGDADFFAWLETEGPRLAA-GDGSARVAAVRRSVEMKAEIVVRDETEQGDRA 250 *************************************9986665.67799999************************ PP TIGR01357 230 lLNfGHtlgHaiEallkyk..lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkk....klsve 300 lLN+GHt+ Ha+Ea+++y+ l HGe VaiG ++++ ls +lgl+ +e+ +r++a l+++g++++l++ ++e lcl|FitnessBrowser__Dino:3608203 251 LLNLGHTFCHALEAATGYSdrLLHGEGVAIGCALAFDLSARLGLCAQEDPSRVRAHLQTMGMKRDLRDiagdLPDAE 327 ******************999***********************************************9997789** PP TIGR01357 301 ellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 +ll+ + +DKK +++++++l++ iG+a+++sev++e++l+ lcl|FitnessBrowser__Dino:3608203 328 ALLNLMGQDKKVMDGTLRFILARGIGQAFMTSEVPSEAVLS 368 ***********************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (383 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory