Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate 3610069 Dshi_3450 shikimate 5-dehydrogenase (RefSeq)
Query= reanno::Caulo:CCNA_00003 (285 letters) >FitnessBrowser__Dino:3610069 Length = 278 Score = 217 bits (552), Expect = 3e-61 Identities = 116/269 (43%), Positives = 157/269 (58%) Query: 11 VGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPAADRFETFVDGLRGGAVRGLNVTI 70 + GV G PI HS SP +H W+ G++ YVP L +G+NVT+ Sbjct: 8 IAGVIGNPITHSRSPHLHRHWLHVYGIEGYYVPLHVQGQDLAEVFHALPKLGFKGVNVTL 67 Query: 71 PFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAIQAPGFDVTAA 130 PFKERA+ +AD SD A + GAAN + F DG++HADNTDG G + + APG+ AA Sbjct: 68 PFKERAIELADRVSDRAALIGAANTITFQPDGTIHADNTDGYGFIENLRNGAPGWSPRAA 127 Query: 131 PVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAKGEDALPALLP 190 +V+LGAGGAARG ++ALL AGAP + + NRT A+A+ L FG +V + + Sbjct: 128 AIVVLGAGGAARGVLSALLEAGAPEVRLANRTRAKAEALRSDFGPRVTVVDWHGVSGTME 187 Query: 191 EAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEAAGRRTVDGLE 250 +A ++N TSLG+ G +L P++AVV D+VY+PL T L +A A G VDGL Sbjct: 188 DAETLVNTTSLGMTGQPDLELNLDALPRSAVVTDIVYRPLMTPLLEQAVARGNPVVDGLG 247 Query: 251 MLLRQAIPTFETIYGQAPSPKIDVRVLAL 279 MLL QA P FE +G P ++R AL Sbjct: 248 MLLFQAAPGFERWFGVRPEITPELRAAAL 276 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 278 Length adjustment: 26 Effective length of query: 259 Effective length of database: 252 Effective search space: 65268 Effective search space used: 65268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 3610069 Dshi_3450 (shikimate 5-dehydrogenase (RefSeq))
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.26970.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-72 229.4 0.0 2.6e-72 229.2 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610069 Dshi_3450 shikimate 5-dehydrogen Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610069 Dshi_3450 shikimate 5-dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 229.2 0.0 2.6e-72 2.6e-72 2 260 .. 8 269 .. 7 277 .. 0.95 Alignments for each domain: == domain 1 score: 229.2 bits; conditional E-value: 2.6e-72 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesa 78 + gviGnpi hS sp +h + l+ g+e+ Y+ ++v+ ++l ++++++ +lg+kGvnvT+PfKe+++el+D+++++a lcl|FitnessBrowser__Dino:3610069 8 IAGVIGNPITHSRSPHLHRHWLHVYGIEGYYVPLHVQGQDLAEVFHALPKLGFKGVNVTLPFKERAIELADRVSDRA 84 689************************************************************************** PP TIGR00507 79 kligavNTlk.ledgklvgynTDgiGlvssLek..lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtve 151 +liga NT++ dg + ++nTDg+G++ +L++ + ++++GAGGaa++v+ +Ll+a ev +aNRt + lcl|FitnessBrowser__Dino:3610069 85 ALIGAANTITfQPDGTIHADNTDGYGFIENLRNgaPGWSPRAAAIVVLGAGGAARGVLSALLEAgAPEVRLANRTRA 161 **********7789******************97445555578999******************6679********* PP TIGR00507 152 kaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkegklvvDlvynpletpllkeakk 228 kae+l + + +++ ++ + + + ++n+ts+g++g+ + e++ + l +++v D+vy pl tpll+ a lcl|FitnessBrowser__Dino:3610069 162 KAEALRSDFGPRVTVVDWHGVSGTMEDAETLVNTTSLGMTGQP-DLELNLDALPRSAVVTDIVYRPLMTPLLEQAVA 237 ***********9*****************************98.99******************************* PP TIGR00507 229 kgtkvidGlgMlvaQaalsFelwtgvepdvek 260 +g +v+dGlgMl Qaa Fe w+gv p++ lcl|FitnessBrowser__Dino:3610069 238 RGNPVVDGLGMLLFQAAPGFERWFGVRPEITP 269 ****************************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (278 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory