Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate 3608668 Dshi_2061 aspartate kinase (RefSeq)
Query= BRENDA::O69077 (412 letters) >FitnessBrowser__Dino:3608668 Length = 412 Score = 415 bits (1067), Expect = e-120 Identities = 222/412 (53%), Positives = 293/412 (71%), Gaps = 4/412 (0%) Query: 1 MALIVQKFGGTSVGTVERIEQVAEKVKKFREAGDDVVVVVSAMSGETNRLIGLANQIMEQ 60 M+++V KFGGTSV +++I+ AEKV++ G V+V+VSAMSG+TN L+G + Sbjct: 1 MSILVMKFGGTSVADLDKIKNAAEKVQREVARGHKVIVIVSAMSGKTNELVGWVGKTSPL 60 Query: 61 PVPRELDVMVSTGEQVTIALLSMALIKRGVPAVSYTGNQVRILTDSAHTKARILHIDDTH 120 RE D +VS+GE VT LL++ L + +PA S+ G QV + T+SAH ARI I + Sbjct: 61 YDAREYDAVVSSGENVTAGLLALTLQEMEIPARSWQGWQVPLRTNSAHAAARIEEIPRAN 120 Query: 121 IRADLKAG-RVVVVAGFQGVDGNGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVY 179 + A G +V V+AGFQG+ G ITTLGRGGSDTT VA AAA A C IYTDVDGVY Sbjct: 121 LDAKFDEGMQVAVIAGFQGISPEGRITTLGRGGSDTTAVAFAAAFGAVRCDIYTDVDGVY 180 Query: 180 TTDPRVVPQARRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFQEGPGTL 239 TTDPR+ +AR+LD+I +EEMLE+ASLG+KVLQ R+VE A ++ VPLRVL SF+E T Sbjct: 181 TTDPRIEDKARKLDRIAYEEMLELASLGAKVLQTRSVELAMRFKVPLRVLSSFEENTDTS 240 Query: 240 IT-IDDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQN 298 T + DE+E ME ++SG+A++RDEAK+T+ V D PG+A I GP+S A V VDMIVQN Sbjct: 241 GTLVCDEDEIMESNVVSGVAYSRDEAKMTLISVADRPGIAAAIFGPLSEAGVNVDMIVQN 300 Query: 299 VAHDNTTDFTFTVHRNDYLNALEILKQT--AANIGAREAIGDTNIAKVSIVGVGMRSHAG 356 ++ D TD TF+ + L A +K+ I +E + DT++AKVS+VG+GMRSHAG Sbjct: 301 ISEDGRTDMTFSCPTDQVLRAERAIKEAKELGEINFQELVADTDVAKVSVVGIGMRSHAG 360 Query: 357 VASRMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPA 408 VA+RMF+AL E INI++I+TSEIK+SV+IE KY+ELAV+ALH AFELD A Sbjct: 361 VAARMFQALRDEGINIRVITTSEIKISVLIERKYMELAVQALHDAFELDRAA 412 Lambda K H 0.317 0.133 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 412 Length adjustment: 31 Effective length of query: 381 Effective length of database: 381 Effective search space: 145161 Effective search space used: 145161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3608668 Dshi_2061 (aspartate kinase (RefSeq))
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.16693.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-127 410.7 6.5 3.9e-127 410.5 6.5 1.0 1 lcl|FitnessBrowser__Dino:3608668 Dshi_2061 aspartate kinase (RefS Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608668 Dshi_2061 aspartate kinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.5 6.5 3.9e-127 3.9e-127 1 406 [. 1 408 [. 1 409 [. 0.96 Alignments for each domain: == domain 1 score: 410.5 bits; conditional E-value: 3.9e-127 TIGR00656 1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisprerdelvs 77 +++ V+KFGGtsv++ ++ik+aa++v +e+ +g+kv+V+vSAms++t+elv + ++s re d +vs lcl|FitnessBrowser__Dino:3608668 1 MSILVMKFGGTSVADLDKIKNAAEKVQREVARGHKVIVIVSAMSGKTNELVGWV------GKTSPLYDAREYDAVVS 71 5799**************************************************......68899999********* PP TIGR00656 78 vGEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegi.ivvvaGFiGateeGeiT 153 GE +++ ll+ l+e + a++ +g++ +++T++ + A+i+e+ +L +eg+ + v+aGF+G eG+iT lcl|FitnessBrowser__Dino:3608668 72 SGENVTAGLLALTLQEMEIPARSWQGWQVPLRTNSAHAAARIEEIPR-ANLDAKFDEGMqVAVIAGFQGISPEGRIT 147 *********************************************99.99*****9996388*************** PP TIGR00656 154 tLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEalelAtlGakvlhpralelaveak 230 tLGRGGSD+tA++ aaa A r++iyTDV+GvyttDPr+ ++a+k+d+i+yeE+lelA+lGakvl+ r++ela++ k lcl|FitnessBrowser__Dino:3608668 148 TLGRGGSDTTAVAFAAAFGAVRCDIYTDVDGVYTTDPRIEDKARKLDRIAYEEMLELASLGAKVLQTRSVELAMRFK 224 ***************************************************************************** PP TIGR00656 231 vpilvrsskeke...egTlitn...kkensslvkaialeknvarltvegegmlgkrgilaeifkaLaeeeinvdlis 301 vp++v ss+e++ +gTl+++ +e ++v+++a++++ a++t+ ++++++gi+a if+ L+e+++nvd+i+ lcl|FitnessBrowser__Dino:3608668 225 VPLRVLSSFEENtdtSGTLVCDedeIMES-NVVSGVAYSRDEAKMTLI--SVADRPGIAAAIFGPLSEAGVNVDMIV 298 ********98654478*****96533334.6*****************..9************************** PP TIGR00656 302 qtese...tsislvvdeedvdeakkaLkeesgaae..lesleveedlavvsivgaglveapGvaseifkaleeknin 373 q se t+++++ + +v +a++a+ke +++ e +++l + d+a+vs+vg g++++ Gva+++f+al++++in lcl|FitnessBrowser__Dino:3608668 299 QNISEdgrTDMTFSCPTDQVLRAERAIKEAKELGEinFQELVADTDVAKVSVVGIGMRSHAGVAARMFQALRDEGIN 375 ***99999*********************998777779*************************************** PP TIGR00656 374 ilmisssetkisvlvdekdaekavrklheklee 406 i i++se+kisvl++ k++e av++lh+++e+ lcl|FitnessBrowser__Dino:3608668 376 IRVITTSEIKISVLIERKYMELAVQALHDAFEL 408 *******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory