Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate 3607379 Dshi_0793 O-acetylhomoserine/O-acetylserine sulfhydrylase (RefSeq)
Query= SwissProt::P06106 (444 letters) >FitnessBrowser__Dino:3607379 Length = 431 Score = 348 bits (894), Expect = e-100 Identities = 195/440 (44%), Positives = 265/440 (60%), Gaps = 15/440 (3%) Query: 2 PSH-FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQ 60 PS+ FDT+Q+HAG D A +R PIY TT YVF ++ H + LF L+ GY+YSR Sbjct: 6 PSYGFDTLQIHAGARP--DPATGARQTPIYQTTGYVFRDADHAAALFNLQEVGYIYSRLT 63 Query: 61 NPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKI 120 NPT VL+ERIA LEGG A+ SSG AAQ +A+ L G NIV ++ LYGGT QF Sbjct: 64 NPTVAVLQERIATLEGGVGAVCCSSGHAAQIMALFPLMQPGCNIVVSTRLYGGTVTQFGQ 123 Query: 121 SFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPV 180 + KRFG A+FV+ D+ + D+ T+AV+ E I NP + D I IA GIP+ Sbjct: 124 TIKRFGWSAKFVDFDDLDAVRAAIDDDTRAVFGEAIANPGGYIMDVRAIADIADAAGIPL 183 Query: 181 VVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQF 240 ++DNT A Y C+PI++GA +V HS TK++ G+GT GG +VDSGKF W KFP Sbjct: 184 IIDNT-TATPYLCRPIEHGATLVVHSTTKYLTGNGTVTGGCVVDSGKFDWA-ASGKFPSL 241 Query: 241 SQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHG 300 S+P YHG + E +G LA+ H LRDLG MNP + L G+ETLSLR RH Sbjct: 242 SEPEPAYHGLRFAETFGPLAFTFHGIAVGLRDLGMTMNPQGAHYTLMGIETLSLRMARHV 301 Query: 301 ENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETD 360 ENA K+AKWLE V +V+Y GL S + E K G G + +F VK A Sbjct: 302 ENAEKIAKWLEADDRVEFVTYAGLPSSPYFERVKTVCPRGAGALFTFAVKGGYEA----- 356 Query: 361 PFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVG 420 ++VD+L++ S++AN+GD ++L+I TTH+QL +++ A+G +++R+S+G Sbjct: 357 -----CIKLVDSLEIFSHVANLGDTRSLIIHSASTTHRQLTPEQQEAAGAAPNVVRLSIG 411 Query: 421 IEFIDDIIADFQQSFETVFA 440 IE DD+IAD Q+ A Sbjct: 412 IEDADDLIADLDQALSKATA 431 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 431 Length adjustment: 32 Effective length of query: 412 Effective length of database: 399 Effective search space: 164388 Effective search space used: 164388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory