Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate 3607347 Dshi_0762 aminotransferase class I and II (RefSeq)
Query= metacyc::MONOMER-21143 (387 letters) >FitnessBrowser__Dino:3607347 Length = 400 Score = 234 bits (598), Expect = 2e-66 Identities = 140/392 (35%), Positives = 209/392 (53%), Gaps = 13/392 (3%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 L+ +L R+ +V A +L+A G+ +I LG G+PDF TPQ++ DA K A+D G Sbjct: 4 LSTSLARVKPSPTIAVTNMANELKAAGRDVIGLGAGEPDFDTPQNIKDAGKAAIDAGKTK 63 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y +GI E ++A+ K K+ D D +V + GGK + A+ PG E+I P P Sbjct: 64 YTAVDGIPELKKAIVAKFKRDNGLDYDTTQVTVANGGKQILINALMATMNPGDEVIIPAP 123 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + Y M+ G PV + + K +++ + IT +T+ I +P+NPTG+ Sbjct: 124 YWVSYPDMVLLAGGEPVIAEASIQTGFKLTADQLEAAITPRTKWFIFNSPSNPTGAGYTA 183 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNY-PDLQDRLIVLDGWSKAYAM 241 + + L + L +HPHV +++D++Y +YD E T P L +R + +G SKAYAM Sbjct: 184 AELKELTDVLLRHPHVWVMTDDMYEHLVYDDFEFATPAQVEPKLYNRTLTCNGVSKAYAM 243 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G++ P+ELI + K+ S S + SQ+A + ALDG D I E F +RR Sbjct: 244 TGWRIGYAAGPKELIGAMRKIQSQSTSNPCSISQWAAVEALDGTQDYIPENNKTFKRRRD 303 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPKVIG----TGMNGSE------FAKKCMHEAGVAIV 351 L+ LN G+ C P GAFY +P + G T G++ FAK + E GVA+V Sbjct: 304 LVVGMLNDAQGISCPKPEGAFYVYPSIAGCIGKTSAGGTKITDDEAFAKALLEEKGVAVV 363 Query: 352 PGTAFGKTCQDYVRFSYAASQDNISNALENIK 383 G AFG R SYA S D ++ A I+ Sbjct: 364 FGAAFG--LSPNFRVSYATSDDALTEACTRIQ 393 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory