Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate 3607759 Dshi_1168 aminotransferase class I and II (RefSeq)
Query= curated2:A0KKB7 (356 letters) >FitnessBrowser__Dino:3607759 Length = 391 Score = 70.9 bits (172), Expect = 5e-17 Identities = 67/210 (31%), Positives = 101/210 (48%), Gaps = 20/210 (9%) Query: 53 PECQPAEVVNGYAAYAGVN--PDQVLVSRGADEAIELLIRTFCEAGEDQILICP--PTYG 108 PE + A + YA + GV+ P +V+V+ G+ A L T+ +AG + P P+Y Sbjct: 69 PELRRA-IAGLYARWYGVDLDPARVVVTSGSSAAFLLAFTTYFDAGARVGVAEPGYPSYR 127 Query: 109 MYAISAETCGVGIVEQPLTTSRQPDWPAIADRLSDVKLVFLCSPNNPTGDLVGRDGLIAL 168 + VG+ QP T R A A +D+ + SPNNPTG ++ RDGL AL Sbjct: 128 QILKALSLAPVGLPTQPETGHRMT---AEALAQADIAGAIIASPNNPTGTMLDRDGLGAL 184 Query: 169 LEKARDR-AIVVVDEAYIEFCPEASVVDLLARFPNLVVTRTLSKAFALAGIRCGFTL--- 224 + RDR + + DE Y V L ++ V + SK F++ G R G+ + Sbjct: 185 IAACRDRDRVFISDEIYHGLHYGDRAVSALEISDDVCVINSFSKYFSMTGWRIGWLVVPE 244 Query: 225 ASPEVIAMLAK---VIAPYPIPEPIAQIAA 251 A V+ LA+ + AP+ +AQIAA Sbjct: 245 AQVRVVERLAQNMFICAPH-----VAQIAA 269 Lambda K H 0.322 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 391 Length adjustment: 30 Effective length of query: 326 Effective length of database: 361 Effective search space: 117686 Effective search space used: 117686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory