Align Histidinol dehydrogenase 1; HDH 1; EC 1.1.1.23 (uncharacterized)
to candidate 3608850 Dshi_2242 Histidinol dehydrogenase (RefSeq)
Query= curated2:Q8YSM8 (431 letters) >FitnessBrowser__Dino:3608850 Length = 441 Score = 279 bits (714), Expect = 1e-79 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 3/410 (0%) Query: 20 SDRREATVDVSGTVRDILAHVKARGDAAVQEYTSRFDHYRPHSHHLSAAFIAEQAAKCSD 79 ++R E TV IL + RGDAAV++ + +FD Y P + LS + I K + Sbjct: 12 TERAEDDARTQATVTGILQDISTRGDAAVRDLSEKFDGYTPQAFRLSPSEIEAAMQKVTT 71 Query: 80 EVKAALELAAERISSFHQKQLPQ--DIGYTDTAGVKLGLNWVALSQVGIYVPGGRASYPS 137 + A ++I +F Q Q D+ GV LG + ++ VG YVPGG+ + Sbjct: 72 REMGDIRFAQDQIRNFAQVQRASMTDVEVETIPGVILGHKNIPVNSVGCYVPGGKFPMVA 131 Query: 138 SVLMNALPAKIAGVERIVMTVPMPHGEINPAVLAAAQVAGVTEIYSIGGAQAVGALAYGT 197 S M+ + AK+AGV+R+V + P G +PA++AA G EI +GG QAVGA+A GT Sbjct: 132 SAHMSVITAKVAGVKRVVASAPPVKGAPHPAIVAAMHEGGADEILVLGGVQAVGAMALGT 191 Query: 198 ETITPVDKIVGPGNAYVAEAKRQVFGTVGIDSIAGPSEILVVADRQNNPEWIAWDLLSQA 257 E+I PVD +VGPGNA+VAEAKRQ+FG VGID AGP+E V+AD + E +A DLL QA Sbjct: 192 ESIAPVDMLVGPGNAFVAEAKRQLFGRVGIDLFAGPTETCVIADDTVDGEMVATDLLGQA 251 Query: 258 EHDPSAQSILITDSESFAQQVIAAVEQILTTLPSQKVASSSWQNHGAVIIVRDLAESIPL 317 EH ++ ++LIT S A+ ++ ++++L LP+ + A SW+++G VI+ D E + + Sbjct: 252 EHGYNSPAVLITCSRKLAEDTLSEIDRLLAILPTAETARVSWEDYGEVILCTDYDEMLRV 311 Query: 318 LNQLAPEHVELCVDNPQLLASQIKCAGSLFLGRYTPEAIGDYLGGPNHVLPTSRSARFAS 377 + +A EHV++ D + G+LFLG T A GD + G NH LPT ++ R+ Sbjct: 312 ADDVASEHVQVMTDRDDWFLDNMTNYGALFLGPRTNVANGDKVIGTNHTLPTKKAGRYTG 371 Query: 378 GLSVYDFLKRITYLE-CNQAALQKIGQSAVTLAETEGLPAHAGSVAVRLQ 426 GL V FLK +Y + A + +G+ L EG HA VR++ Sbjct: 372 GLWVGKFLKTHSYQKVLTDEAAKLVGEYGSRLCMLEGFVGHAEQCNVRVR 421 Lambda K H 0.316 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 441 Length adjustment: 32 Effective length of query: 399 Effective length of database: 409 Effective search space: 163191 Effective search space used: 163191 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate 3608850 Dshi_2242 (Histidinol dehydrogenase (RefSeq))
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.24126.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-133 430.6 0.0 4.2e-133 430.3 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608850 Dshi_2242 Histidinol dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608850 Dshi_2242 Histidinol dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.3 0.0 4.2e-133 4.2e-133 1 393 [] 25 419 .. 25 419 .. 0.97 Alignments for each domain: == domain 1 score: 430.3 bits; conditional E-value: 4.2e-133 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlpes..veve 75 v+ i++d+ ++Gd+A+++++ekfd+++++++r+s +e+e+a+++v+ + +++ a+++i++f++ q+++ veve lcl|FitnessBrowser__Dino:3608850 25 VTGILQDISTRGDAAVRDLSEKFDGYTPQAFRLSPSEIEAAMQKVTTREMGDIRFAQDQIRNFAQVQRASMtdVEVE 101 678***************************************************************997754599** PP TIGR00069 76 teegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdevyk 152 t +gv+lg+k p+++vg+YvPgGk ++++++ m +++AkvAgvk++v+ +Pp +g +pa++aa++ g+de++ lcl|FitnessBrowser__Dino:3608850 102 TIPGVILGHKNIPVNSVGCYVPGGKFPMVASAHMSVITAKVAGVKRVVASAPPV-KGAPHPAIVAAMHEGGADEILV 177 *****************************************************6.9********************* PP TIGR00069 153 vGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqaEHd 229 +GG+qa++a+a Gte++ +vd++vGPGn++V++AK+++fg+vgid++aGP+E +viad++ + e+va+Dll qaEH+ lcl|FitnessBrowser__Dino:3608850 178 LGGVQAVGAMALGTESIAPVDMLVGPGNAFVAEAKRQLFGRVGIDLFAGPTETCVIADDTVDGEMVATDLLGQAEHG 254 ***************************************************************************** PP TIGR00069 230 edaqailvttseelaekveeeveeqleelerkeiaekslekngaiilvddleealelsneyApEHLelqtkdpeell 306 ++ a+l+t s++lae++ +e+++ l+ l+++e+a+ s+e++g++il+ d++e+l++++++A EH++++t+ +l lcl|FitnessBrowser__Dino:3608850 255 YNSPAVLITCSRKLAEDTLSEIDRLLAILPTAETARVSWEDYGEVILCTDYDEMLRVADDVASEHVQVMTDRDDWFL 331 ***************************************************************************** PP TIGR00069 307 kkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqel.skealeelaeaveklaeaEg 382 ++++n+G++flG+ t +a gd+v G+nh+LPT+++ r+++gl+v +Flk+ s+q++ + ea++ ++e ++l+ +Eg lcl|FitnessBrowser__Dino:3608850 332 DNMTNYGALFLGPRTNVANGDKVIGTNHTLPTKKAGRYTGGLWVGKFLKTHSYQKVlTDEAAKLVGEYGSRLCMLEG 408 ******************************************************9725566666788899******* PP TIGR00069 383 LeaHaeavevR 393 + Hae +vR lcl|FitnessBrowser__Dino:3608850 409 FVGHAEQCNVR 419 ******99988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (441 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory