Align threonine deaminase (EC 4.3.1.19) (characterized)
to candidate 3610092 Dshi_3473 threonine dehydratase (RefSeq)
Query= reanno::Pedo557:CA265_RS15860 (416 letters) >FitnessBrowser__Dino:3610092 Length = 413 Score = 384 bits (987), Expect = e-111 Identities = 203/405 (50%), Positives = 269/405 (66%), Gaps = 4/405 (0%) Query: 14 ASQRLKGVVKRTPLEFNAGLSAHYNANIYLKREDLQIVRSYKLRGAYNKISSLPQDALIN 73 A+ ++ + TPL+ N LS Y A I+LKREDL VRSYK+RGA+N IS + Sbjct: 11 AASAMRPLFPATPLQMNIHLSERYGAEIWLKREDLSPVRSYKIRGAFNAISKRVAEGQTQ 70 Query: 74 GVVCASAGNHAQGVAYSCKKLGIKGVIFMPEITPKQKVKQTYMFGGDNVEVVLVGDTFDD 133 CASAGNHAQGVAY+C+ G+ GVIFMP TP+QK+ +T +FGG +++ LVGD FDD Sbjct: 71 -FACASAGNHAQGVAYACQHFGVHGVIFMPVTTPRQKIDKTRIFGGTAIDIELVGDYFDD 129 Query: 134 CLKEALAYSAEKSATFIPPFDDEKVIEGQATVGVEIYEDLP-DLDMIVMPVGGGGLASGV 192 L A Y E SATF+ PFDD VIEGQ+TV VE+ E L DM+++PVGGGGL+SG+ Sbjct: 130 TLAAAQRYCTEASATFLSPFDDADVIEGQSTVAVELLEQLEGPPDMVILPVGGGGLSSGM 189 Query: 193 SAYMKTVKPEVKLVGVEPLGAPSMVTAMEYGGPFTLEEIDRFVDGAAVKRIGHITYEYCK 252 Y + +V L VEP GA S+ A+E G P TL ++D FVDGAAV RIG +E + Sbjct: 190 KRYFEVCGVQVDLRLVEPCGARSLAKALETGAPQTLSKVDNFVDGAAVARIGARPFEILR 249 Query: 253 EL-LDQMHLIPEGKICTTILKLYNEDAIVVEPAGALSVAALDQLKDQITGKTVVCIVSGG 311 ++ D + PE +IC T+L++ N + IV+EPAGAL+V LD L+D ITGK VVC+ SGG Sbjct: 250 DVPPDHVLGAPEDRICHTMLEMLNVEGIVLEPAGALAVDVLDTLRDSITGKRVVCVTSGG 309 Query: 312 NNDIERMQEIKEKSLLFEGLKHYFIVRFPQRPGALKLFVNEVLGPQDDITRFEFIKKTNK 371 N D ER+ E+KE+SL + GLK YFI+R PQRPGALK F+ LGP DDI RFE++KK+ + Sbjct: 310 NFDFERLPEVKERSLRYAGLKKYFILRLPQRPGALKEFLG-FLGPDDDIARFEYLKKSAR 368 Query: 372 ENGPALVGIELSNKNDYASLLQRMKDFKFEIIELNQDQTLFEYLV 416 G L+GIE + + L R+ F ++ +D L E+L+ Sbjct: 369 NFGSVLIGIETKDAGAFEQLFARLDAAGFPFRDITEDALLAEFLI 413 Lambda K H 0.318 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 413 Length adjustment: 31 Effective length of query: 385 Effective length of database: 382 Effective search space: 147070 Effective search space used: 147070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3610092 Dshi_3473 (threonine dehydratase (RefSeq))
to HMM TIGR02079 (ilvA: threonine dehydratase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02079.hmm # target sequence database: /tmp/gapView.16068.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02079 [M=410] Accession: TIGR02079 Description: THD1: threonine dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-166 538.0 0.0 7.6e-166 537.9 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610092 Dshi_3473 threonine dehydratase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610092 Dshi_3473 threonine dehydratase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 537.9 0.0 7.6e-166 7.6e-166 4 410 .] 9 413 .] 6 413 .] 0.97 Alignments for each domain: == domain 1 score: 537.9 bits; conditional E-value: 7.6e-166 TIGR02079 4 ekakkrlkevvketPlqknerlsekykaeiylkredlqevrsyklrGaynkl.kqlsdeelekgvvcasaGnhaqGv 79 ++a+ +++++ tPlq+n +lse+y+aei+lkredl+ vrsyk+rGa+n++ k++++ + + casaGnhaqGv lcl|FitnessBrowser__Dino:3610092 9 HRAASAMRPLFPATPLQMNIHLSERYGAEIWLKREDLSPVRSYKIRGAFNAIsKRVAEG--QTQFACASAGNHAQGV 83 689999**********************************************4455544..45699*********** PP TIGR02079 80 ayacrklgvkgtvfmPvttPkqkvdkvklfGgefievilvGdtfdeaaaaakkavekegktlipPfddkdiieGqgt 156 ayac+++gv+g++fmPvttP+qk+dk+++fGg i++ lvGd fd++ aaa++ + + +t++ Pfdd d+ieGq+t lcl|FitnessBrowser__Dino:3610092 84 AYACQHFGVHGVIFMPVTTPRQKIDKTRIFGGTAIDIELVGDYFDDTLAAAQRYCTEASATFLSPFDDADVIEGQST 160 ***************************************************************************** PP TIGR02079 157 vaveileqleeekidlvlvpvGGGGlisGvtsylkekskktkiigvePeGapslkaslkagevvtldkidkfvdGaa 233 vave+leqle + +d+v++pvGGGGl+sG+ y++ + ++ veP Ga sl ++l++g + tl k+d+fvdGaa lcl|FitnessBrowser__Dino:3610092 161 VAVELLEQLEGP-PDMVILPVGGGGLSSGMKRYFEVCGVQVDLRLVEPCGARSLAKALETGAPQTLSKVDNFVDGAA 236 **********98.**************************************************************** PP TIGR02079 234 vkrvGdlnfkalkkvvd.evtlveegavcstildlynkegivaePaGalsiaaleelseeikgktvvcvvsGgnndi 309 v+r+G f++l++v +v +e+++c t+l+++n egiv+ePaGal++ l++l++ i+gk vvcv sGgn+d+ lcl|FitnessBrowser__Dino:3610092 237 VARIGARPFEILRDVPPdHVLGAPEDRICHTMLEMLNVEGIVLEPAGALAVDVLDTLRDSITGKRVVCVTSGGNFDF 313 ***************865999******************************************************** PP TIGR02079 310 erleeikersllyeGlkhyflvkfpqraGalreflndvlGPndditkfeyvkksnretGevliGielsdkedfeGll 386 erl+e+kersl+y Glk+yf++++pqr+Gal+efl lGP+ddi++fey+kks+r++G+vliGie++d+ fe l+ lcl|FitnessBrowser__Dino:3610092 314 ERLPEVKERSLRYAGLKKYFILRLPQRPGALKEFLG-FLGPDDDIARFEYLKKSARNFGSVLIGIETKDAGAFEQLF 389 ***********************************9.**************************************** PP TIGR02079 387 erlkaadieyeainenetlyellv 410 +rl+aa+ +++i+e+ l e+l+ lcl|FitnessBrowser__Dino:3610092 390 ARLDAAGFPFRDITEDALLAEFLI 413 *****************9999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (410 nodes) Target sequences: 1 (413 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.05 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory